KEGG   Homo sapiens (human): 27429
Entry
27429             CDS       T01001                                 

Gene name
HTRA2, MGCA8, OMI, PARK13, PRSS25
Definition
(RefSeq) HtrA serine peptidase 2
  KO
K08669  HtrA serine peptidase 2 [EC:3.4.21.108]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04210  Apoptosis
hsa04215  Apoptosis - multiple species
hsa05012  Parkinson disease
hsa05022  Pathways of neurodegeneration - multiple diseases
Network
nt06414  Apoptosis
nt06463  Parkinson disease
  Element
N01048  Mutation-inactivated PINK1 to intrinsic apoptotic pathway
Disease
H00057  Parkinson disease
H00754  3-Methylglutaconic aciduria
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    27429 (HTRA2)
   04215 Apoptosis - multiple species
    27429 (HTRA2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05012 Parkinson disease
    27429 (HTRA2)
   05022 Pathways of neurodegeneration - multiple diseases
    27429 (HTRA2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    27429 (HTRA2)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:hsa03110]
    27429 (HTRA2)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.108  HtrA2 peptidase
     27429 (HTRA2)
Peptidases and inhibitors [BR:hsa01002]
 Serine peptidases
  Family S1: chymotrypsin family
   27429 (HTRA2)
Chaperones and folding catalysts [BR:hsa03110]
 Other chaperones and cochaperones
  DegP / HtrA
   27429 (HTRA2)
SSDB
Motif
Pfam: Trypsin_2 Trypsin PDZ_6 PDZ_2 PDZ Peptidase_S46 GRASP55_65 Tricorn_PDZ
Other DBs
NCBI-GeneID: 27429
NCBI-ProteinID: NP_037379
OMIM: 606441
HGNC: 14348
Ensembl: ENSG00000115317
Vega: OTTHUMG00000129957
Pharos: O43464(Tbio)
UniProt: O43464 A0A384MDW9
Structure
PDB: 

Position
2p13.1
AA seq 458 aa
MAAPRAGRGAGWSLRAWRALGGIRWGRRPRLTPDLRALLTSGTSDPRARVTYGTPSLWAR
LSVGVTEPRACLTSGTPGPRAQLTAVTPDTRTREASENSGTRSRAWLAVALGAGGAVLLL
LWGGGRGPPAVLAAVPSPPPASPRSQYNFIADVVEKTAPAVVYIEILDRHPFLGREVPIS
NGSGFVVAADGLIVTNAHVVADRRRVRVRLLSGDTYEAVVTAVDPVADIATLRIQTKEPL
PTLPLGRSADVRQGEFVVAMGSPFALQNTITSGIVSSAQRPARDLGLPQTNVEYIQTDAA
IDFGNSGGPLVNLDGEVIGVNTMKVTAGISFAIPSDRLREFLHRGEKKNSSSGISGSQRR
YIGVMMLTLSPSILAELQLREPSFPDVQHGVLIHKVILGSPAHRAGLRPGDVILAIGEQM
VQNAEDVYEAVRTQSQLAVQIRRGRETLTLYVTPEVTE
NT seq 1377 nt   +upstreamnt  +downstreamnt
atggctgcgccgagggcggggcggggtgcaggctggagccttcgggcatggcgggctttg
gggggcattcgctgggggaggagaccccgtttgacccctgacctccgggccctgctgacg
tcaggaacttctgacccccgggcccgagtgacttatgggacccccagtctctgggcccgg
ttgtctgttggggtcactgaaccccgagcatgcctgacgtctgggaccccgggtccccgg
gcacaactgactgcggtgaccccagataccaggacccgggaggcctcagagaactctgga
acccgttcgcgcgcgtggctggcggtggcgctgggcgctgggggggcagtgctgttgttg
ttgtggggcgggggtcggggtcctccggccgtcctcgccgccgtccctagcccgccgccc
gcttctccccggagtcagtacaacttcatcgcagatgtggtggagaagacagcacctgcc
gtggtctatatcgagatcctggaccggcaccctttcttgggccgcgaggtccctatctcg
aacggctcaggattcgtggtggctgccgatgggctcattgtcaccaacgcccatgtggtg
gctgatcggcgcagagtccgtgtgagactgctaagcggcgacacgtatgaggccgtggtc
acagctgtggatcccgtggcagacatcgcaacgctgaggattcagactaaggagcctctc
cccacgctgcctctgggacgctcagctgatgtccggcaaggggagtttgttgttgccatg
ggaagtccctttgcactgcagaacacgatcacatccggcattgttagctctgctcagcgt
ccagccagagacctgggactcccccaaaccaatgtggaatacattcaaactgatgcagct
attgattttggaaactctggaggtcccctggttaacctggatggggaggtgattggagtg
aacaccatgaaggtcacagctggaatctcctttgccatcccttctgatcgtcttcgagag
tttctgcatcgtggggaaaagaagaattcctcctccggaatcagtgggtcccagcggcgc
tacattggggtgatgatgctgaccctgagtcccagcatccttgctgaactacagcttcga
gaaccaagctttcccgatgttcagcatggtgtactcatccataaagtcatcctgggctcc
cctgcacaccgggctggtctgcggcctggtgatgtgattttggccattggggagcagatg
gtacaaaatgctgaagatgtttatgaagctgttcgaacccaatcccagttggcagtgcag
atccggcggggacgagaaacactgaccttatatgtgacccctgaggtcacagaatga

KEGG   Homo sapiens (human): 10131
Entry
10131             CDS       T01001                                 

Gene name
TRAP1, HSP_75, HSP75, HSP90L, TRAP-1
Definition
(RefSeq) TNF receptor associated protein 1
  KO
K09488  TNF receptor-associated protein 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa05012  Parkinson disease
hsa05022  Pathways of neurodegeneration - multiple diseases
Network
nt06414  Apoptosis
nt06463  Parkinson disease
  Element
N01048  Mutation-inactivated PINK1 to intrinsic apoptotic pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09164 Neurodegenerative disease
   05012 Parkinson disease
    10131 (TRAP1)
   05022 Pathways of neurodegeneration - multiple diseases
    10131 (TRAP1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:hsa03110]
    10131 (TRAP1)
Chaperones and folding catalysts [BR:hsa03110]
 Heat shock proteins
  HSP90
   10131 (TRAP1)
SSDB
Motif
Pfam: HSP90 HATPase_c_3 HATPase_c
Other DBs
NCBI-GeneID: 10131
NCBI-ProteinID: NP_057376
OMIM: 606219
HGNC: 16264
Ensembl: ENSG00000126602
Vega: OTTHUMG00000129427
Pharos: Q12931(Tchem)
UniProt: Q12931 A0A140VJY2
Structure
PDB: 

Position
16p13.3
AA seq 704 aa
MARELRALLLWGRRLRPLLRAPALAAVPGGKPILCPRRTTAQLGPRRNPAWSLQAGRLFS
TQTAEDKEEPLHSIISSTESVQGSTSKHEFQAETKKLLDIVARSLYSEKEVFIRELISNA
SDALEKLRHKLVSDGQALPEMEIHLQTNAEKGTITIQDTGIGMTQEELVSNLGTIARSGS
KAFLDALQNQAEASSKIIGQFGVGFYSAFMVADRVEVYSRSAAPGSLGYQWLSDGSGVFE
IAEASGVRTGTKIIIHLKSDCKEFSSEARVRDVVTKYSNFVSFPLYLNGRRMNTLQAIWM
MDPKDVREWQHEEFYRYVAQAHDKPRYTLHYKTDAPLNIRSIFYVPDMKPSMFDVSRELG
SSVALYSRKVLIQTKATDILPKWLRFIRGVVDSEDIPLNLSRELLQESALIRKLRDVLQQ
RLIKFFIDQSKKDAEKYAKFFEDYGLFMREGIVTATEQEVKEDIAKLLRYESSALPSGQL
TSLSEYASRMRAGTRNIYYLCAPNRHLAEHSPYYEAMKKKDTEVLFCFEQFDELTLLHLR
EFDKKKLISVETDIVVDHYKEEKFEDRSPAAECLSEKETEELMAWMRNVLGSRVTNVKVT
LRLDTHPAMVTVLEMGAARHFLRMQQLAKTQEERAQLLQPTLEINPRHALIKKLNQLRAS
EPGLAQLLVDQIYENAMIAAGLVDDPRAMVGRLNELLVKALERH
NT seq 2115 nt   +upstreamnt  +downstreamnt
atggcgcgcgagctgcgggcgctgctgctgtggggccgccgcctgcggcctttgctgcgg
gcgccggcgctggcggccgtgccgggaggaaaaccaattctgtgtcctcggaggaccaca
gcccagttgggccccaggcgaaacccagcctggagcttgcaggcaggacgactgttcagc
acgcagaccgccgaggacaaggaggaacccctgcactcgattatcagcagcacagagagc
gtgcagggttccacttccaaacatgagttccaggccgagacaaagaagcttttggacatt
gttgcccggtccctgtactcagaaaaagaggtgtttatacgggagctgatctccaatgcc
agcgatgccttggaaaaactgcgtcacaaactggtgtctgacggccaagcactgccagaa
atggagattcacttgcagaccaatgccgagaaaggcaccatcaccatccaggatactggt
atcgggatgacacaggaagagctggtgtccaacctggggacgattgccagatcggggtca
aaggccttcctggatgctctgcagaaccaggctgaggccagcagcaagatcatcggccag
tttggagtgggtttctactcagctttcatggtggctgacagagtggaggtctattcccgc
tcggcagccccggggagcctgggttaccagtggctttcagatggttctggagtgtttgaa
atcgccgaagcttcgggagttagaaccgggacaaaaatcatcatccacctgaaatccgac
tgcaaggagttttccagcgaggcccgggtgcgagatgtggtaacgaagtacagcaacttc
gtcagcttccccttgtacttgaatggaaggcggatgaacaccttgcaggccatctggatg
atggaccccaaggatgtccgtgagtggcaacatgaggagttctaccgctacgtcgcgcag
gctcacgacaagccccgctacaccctgcactataagacggacgcaccgctcaacatccgc
agcatcttctacgtgcccgacatgaaaccgtccatgtttgatgtgagccgggagctgggc
tccagcgttgcactgtacagccgcaaagtcctcatccagaccaaggccacggacatcctg
cccaagtggctgcgcttcatccgaggtgtggtggacagtgaggacattcccctgaacctc
agccgggagctgctgcaggagagcgcactcatcaggaaactccgggacgttttacagcag
aggctgatcaaattcttcattgaccagagtaaaaaagatgctgagaagtatgcaaagttt
tttgaagattacggcctgttcatgcgggagggcattgtgaccgccaccgagcaggaggtc
aaggaggacatagcaaagctgctgcgctacgagtcctcggcgctgccctccgggcagcta
accagcctctcagaatacgccagccgcatgcgggccggcacccgcaacatctactacctg
tgcgcccccaaccgtcacctggcagagcactcaccctactatgaggccatgaagaagaaa
gacacagaggttctcttctgctttgagcagtttgatgagctcaccctgctgcaccttcgt
gagtttgacaagaagaagctgatctctgtggagacggacatagtcgtggatcactacaag
gaggagaagtttgaggacaggtccccagccgccgagtgcctatcagagaaggagacggag
gagctcatggcctggatgagaaatgtgctggggtcgcgtgtcaccaacgtgaaggtgacc
ctccgactggacacccaccctgccatggtcaccgtgctggagatgggggctgcccgccac
ttcctgcgcatgcagcagctggccaagacccaggaggagcgcgcacagctcctgcagccc
acgctggagatcaaccccaggcacgcgctcatcaagaagctgaatcagctgcgcgcaagc
gagcctggcctggctcagctgctggtggatcagatatacgagaacgccatgattgctgct
ggacttgttgacgaccctagggccatggtgggccgcttgaatgagctgcttgtcaaggcc
ctggagcgacactga

DBGET integrated database retrieval system