KEGG   Homo sapiens (human): 2743Help
Entry
2743              CDS       T01001                                 

Gene name
GLRB, HKPX2
Definition
(RefSeq) glycine receptor beta
  KO
K05196  glycine receptor beta
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
Disease
H00769  Hyperekplexia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    2743 (GLRB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    2743 (GLRB)
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    2743 (GLRB)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Acrosomal exocytosis proteins
    2743 (GLRB)
Ion channels [BR:hsa04040]
 Ligand-gated channels
  Glycine
   2743 (GLRB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Neur_chan_LBD Neur_chan_memb DUF3267
Motif
Other DBs
NCBI-GeneID: 2743
NCBI-ProteinID: NP_000815
OMIM: 138492
HGNC: 4329
Ensembl: ENSG00000109738
Vega: OTTHUMG00000161954
Pharos: P48167(Tclin)
UniProt: P48167
Position
4q32.1
AA seq 497 aa AA seqDB search
MKFLLTTAFLILISLWVEEAYSKEKSSKKGKGKKKQYLCPSQQSAEDLARVPANSTSNIL
NRLLVSYDPRIRPNFKGIPVDVVVNIFINSFGSIQETTMDYRVNIFLRQKWNDPRLKLPS
DFRGSDALTVDPTMYKCLWKPDLFFANEKSANFHDVTQENILLFIFRDGDVLVSMRLSIT
LSCPLDLTLFPMDTQRCKMQLESFGYTTDDLRFIWQSGDPVQLEKIALPQFDIKKEDIEY
GNCTKYYKGTGYYTCVEVIFTLRRQVGFYMMGVYAPTLLIVVLSWLSFWINPDASAARVP
LGIFSVLSLASECTTLAAELPKVSYVKALDVWLIACLLFGFASLVEYAVVQVMLNNPKRV
EAEKARIAKAEQADGKGGNVAKKNTVNGTGTPVHISTLQVGETRCKKVCTSKSDLRSNDF
SIVGSLPRDFELSNYDCYGKPIEVNNGLGKSQAKNNKKPPPAKPVIPTAAKRIDLYARAL
FPFCFLFFNVIYWSIYL
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgaagtttttattgacaactgcctttttaattttaatttccttgtgggtggaagaagcc
tattctaaggaaaagtcttcaaagaaagggaaggggaaaaagaagcagtatctatgccca
tctcagcagtcagcagaggaccttgcccgagtacctgccaactccactagcaatatcttg
aacaggttattggtcagttatgatcccaggataagaccaaacttcaaaggcattcctgtt
gatgtagtagtcaacatttttattaacagttttggatccattcaagaaacaacaatggac
tatagagttaacatcttcctgagacaaaaatggaatgaccccaggctgaagctccccagt
gattttaggggttcagatgcactgacagtggatccaacaatgtacaagtgtttatggaaa
cctgatttattttttgcaaatgaaaaaagtgccaattttcatgatgtgacccaggaaaac
atcctcctctttatttttcgtgatggagatgtccttgtcagcatgaggttatctattact
ctttcatgccctttggacttgacattgtttcccatggatacacaacgttgcaagatgcaa
ctggagagctttggttacacaactgatgatttacgatttatctggcagtcaggagatcct
gtgcaattagaaaaaattgccttgcctcaatttgatatcaaaaaggaagatattgaatat
ggtaactgtacaaaatactataaaggcacgggctactacacatgcgtggaagtcatcttc
accctgaggaggcaggtcggcttttacatgatgggggtctacgccccaactctgctcatt
gttgttctctcctggctttccttctggatcaacccggacgcgagtgctgccagagtgccc
ctgggtatcttctcagtcctcagcttggcctctgagtgcacaacccttgccgctgagctt
cccaaagtttcctatgtgaaggctcttgatgtttggcttattgcttgccttctctttggg
tttgcttccctggtggagtatgcagttgtccaggtgatgctgaacaaccccaaaagggtt
gaagctgaaaaagccagaattgctaaggctgagcaagcagatggaaaaggtggaaatgtg
gctaaaaagaatactgtgaatggaacagggactcctgttcatattagcactttgcaggtt
ggtgagaccagatgcaaaaaagtttgtacttctaagtctgatctgagatctaatgacttc
agcattgttggaagcttaccaagagattttgaactatccaattatgactgctatggaaaa
cccattgaagttaacaacggacttgggaaatctcaggctaagaacaacaagaagcctccc
cctgcgaaacctgttattccaacagcagcaaagcgaattgatctttatgcaagagcattg
tttcctttctgcttcttgttcttcaatgttatatattggtctatatatttatga

DBGET integrated database retrieval system