KEGG   Homo sapiens (human): 27443Help
Entry
27443             CDS       T01001                                 

Gene name
CECR2
Definition
(RefSeq) CECR2 histone acetyl-lysine reader
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: Bromodomain WSD DDT MSA-2c RNA_pol_Rpc4
Motif
Other DBs
NCBI-GeneID: 27443
NCBI-ProteinID: NP_001276976
OMIM: 607576
HGNC: 1840
Ensembl: ENSG00000099954
Vega: OTTHUMG00000150072
Pharos: Q9BXF3(Tchem)
UniProt: Q9BXF3
Structure
PDB: 

Position
22q11.1-q11.21
AA seq 1464 aa AA seqDB search
MCPEEGGAAGLGELRSWWEVPAIAHFCSLFRTAFRLPDFEIEELEAALHRDDVEFISDLI
ACLLQGCYQRRDITPQTFHSYLEDIINYRWELEEGKPNPLREASFQDLPLRTRVEILHRL
CDYRLDADDVFDLLKGLDADSLRVEPLGEDNSGALYWYFYGTRMYKEDPVQGKSNGELSL
SRESEGQKNVSSIPGKTGKRRGRPPKRKKLQEEILLSEKQEENSLASEPQTRHGSQGPGQ
GTWWLLCQTEEEWRQVTESFRERTSLRERQLYKLLSEDFLPEICNMIAQKGKRPQRTKAE
LHPRWMSDHLSIKPVKQEETPVLTRIEKQKRKEEEEERQILLAVQKKEQEQMLKEERKRE
LEEKVKAVEDRAKRRKLREERAWLLAQGKELPPELSHLDPNSPMREEKKTKDLFELDDDF
TAMYKVLDVVKAHKDSWPFLEPVDESYAPNYYQIIKAPMDISSMEKKLNGGLYCTKEEFV
NDMKTMFRNCRKYNGESSEYTKMSDNLERCFHRAMMKHFPGEDGDTDEEFWIREDEKREK
RRSRAGRSGGSHVWTRSRDPEGSSRKQQPMENGGKSLPPTRRAPSSGDDQSSSSTQPPRE
VGTSNGRGFSHPLHCGGTPSQAPFLNQMRPAVPGTFGPLRGSDPATLYGSSGVPEPHPGE
PVQQRQPFTMQPPVGINSLRGPRLGTPEEKQMCGGLTHLSNMGPHPGSLQLGQISGPSQD
GSMYAPAQFQPGFIPPRHGGAPARPPDFPESSEIPPSHMYRSYKYLNRVHSAVWNGNHGA
TNQGPLGPDEKPHLGPGPSHQPRTLGHVMDSRVMRPPVPPNQWTEQSGFLPHGVPSSGYM
RPPCKSAGHRLQPPPVPAPSSLFGAPAQALRGVQGGDSMMDSPEMIAMQQLSSRVCPPGV
PYHPHQPAHPRLPGPFPQVAHPMSVTVSAPKPALGNPGRAPENSEAQEPENDQAEPLPGL
EEKPPGVGTSEGVYLTQLPHPTPPLQTDCTRQSSPQERETVGPELKSSSSESADNCKAMK
GKNPWPSDSSYPGPAAQGCVRDLSTVADRGALSENGVIGEASPCGSEGKGLGSSGSEKLL
CPRGRTLQETMPCTGQNAATPPSTDPGLTGGTVSQFPPLYMPGLEYPNSAAHYHISPGLQ
GVGPVMGGKSPASHPQHFPPRGFQSNHPHSGGFPRYRPPQGMRYSYHPPPQPSYHHYQRT
PYYACPQSFSDWQRPLHPQGSPSGPPASQPPPPRSLFSDKNAMASLQGCETLNAALTSPT
RMDAVAAKVPNDGQNPGPEEEKLDESMERPESPKEFLDLDNHNAATKRQSSLSASEYLYG
TPPPLSSGMGFGSSAFPPHSVMLQTGPPYTPQRPASHFQPRAYSSPVAALPPHHPGATQP
NGLSQEGPIYRCQEEGLGHFQAVMMEQIGTRSGIRGPFQEMYRPSGMQMHPVQSQASFPK
TPTAATSQEEVPPHKPPTLPLDQS
NT seq 4395 nt NT seq  +upstreamnt  +downstreamnt
atgtgcccagaggagggcggcgcggccgggctgggcgagctccgctcctggtgggaggtc
ccggccatcgcgcacttctgctcgctctttcgcaccgcgttccgcctgcccgacttcgag
atcgaggagttagaagccgctcttcacagagatgacgtggagtttatcagtgacctgatt
gcctgcctgcttcagggctgctatcaacgaagagatatcacgcctcagacattccacagc
tacctagaggacatcatcaactaccgctgggagctcgaagaagggaagcccaaccctctg
agggaagccagtttccaggacctgcctcttcgcacacgggtggagatcctgcaccgactc
tgtgattaccggctggatgcagacgatgtcttcgatcttctaaagggcctggatgcagac
agtctccgtgtggagccattgggtgaagacaattctggggcactatattggtatttctat
ggaacacgaatgtacaaagaggacccggtgcaaggaaaatccaatggagaactctctttg
agcagggaaagtgaaggacaaaaaaatgtctcaagtattcctggaaaaacgggaaaaaga
agaggaagacccccaaaacggaagaaactgcaggaggagattctgttgagtgaaaagcag
gaagaaaattccttggcatccgagccacagacaagacatgggtcccaagggccaggccaa
ggtacttggtggctcctgtgccagacagaagaggaatggagacaggtcaccgagagtttt
cgcgagaggacctcccttcgagaacggcagctctacaagctcctcagtgaggacttcctg
cctgagatctgcaacatgatcgcccagaagggaaaacgtccacagcgcacaaaggcagag
ttgcatcctaggtggatgtctgaccacctgtccatcaaacccgtcaagcaagaggagact
cctgtgctgaccagaatagaaaaacaaaagcgcaaagaggaggaagaagagcgtcagatt
cttctagcagtgcagaagaaggagcaggagcagatgctaaaggaagagaggaaacgcgag
ttggaggagaaggtcaaggcagtggaagatcgagcgaagaggagaaagctcagggaagaa
agggcatggctgctggctcaaggaaaggagctccctccagaactttcccatctggacccc
aattcccccatgagagaggaaaaaaagactaaagacctctttgagttggatgatgatttc
actgctatgtataaagttctagacgtggtaaaggctcacaaggattcctggcccttcttg
gaacctgtggatgaatcttatgcccctaactattatcagattattaaggcccccatggat
atttccagcatggagaagaaactgaatggaggtttatactgtaccaaggaggaatttgta
aatgacatgaagaccatgttcaggaattgtcgaaagtataatggggaaagtagtgagtat
accaagatgtctgataatttagagaggtgtttccatcgggcaatgatgaaacattttcct
ggagaagatggagacacagatgaagaattttggattcgagaggatgaaaagcgggagaaa
agacggagtcgggctgggcgaagtggtgggagccatgtttggacccgctccagggaccca
gaagggtccagcaggaaacagcagcccatggagaatggaggaaagtcgttgccccccaca
cgccgagcgccctcttctggggacgatcagagcagcagctccacacagcccccgcgggag
gtgggcacttccaatggccgaggtttttctcatcccctgcattgtggtgggacacccagc
caggcaccctttttaaaccagatgaggccagcagtaccaggaacatttggccctctgcga
ggatcagatcctgccaccttgtatggctcctctggagtcccggagccacaccccggggag
cctgtgcagcagcgtcagcctttcaccatgcagcctccagttggaattaacagcctccga
ggacccaggctaggcacaccagaggagaagcaaatgtgcggggggctgacacacctttct
aacatgggcccacaccctggatccttgcagcttgggcagataagtggcccaagtcaggat
ggaagcatgtatgctccagctcagttccagccaggattcattcctccccggcatgggggg
gctccagcccggccaccagactttcctgaaagctcagaaattcctcccagccatatgtat
cgatcgtacaagtacctgaatcgagtacactctgccgtctggaatgggaaccatggtgct
acgaaccaaggacccttgggcccagatgagaagccccacctggggccaggaccctctcac
cagcctcgcactctcggtcacgtgatggattcccgagtcatgagaccacctgtccccccc
aaccagtggactgaacaatcaggcttcctacctcatggagttccttcctcagggtacatg
cgaccgccctgcaagtctgccggacatcggttacagccacctccagtgccagcacccagt
tctttgtttggagcacctgcccaggctcttcggggggtgcagggaggggactccatgatg
gacagcccagagatgattgcgatgcagcagctctcctcccgcgtctgccccccaggtgtg
ccttaccacccccaccagcctgcacacccccgtttacctggcccttttccgcaggtagct
cacccaatgtcagtcactgtgtcagcccccaagcctgccctgggcaaccctgggagggca
ccggagaacagtgaagcacaagagcctgagaatgaccaagcagagccgttgcctggcctt
gaagagaaaccaccaggtgttggtacttcagagggggtctacctcacacaactacctcac
cccacacctcccctgcagactgactgcaccaggcagagctcaccacaagaaagggaaaca
gtgggcccggagctcaaaagcagctcctccgaatctgcggacaactgtaaagcaatgaag
ggcaagaatccctggccctcggatagcagctaccccggcccagccgcccaagggtgcgtg
agagacctctccacggtggcagacaggggcgctctatccgagaacggagtcattggggaa
gcatctccttgtggatcggaggggaagggccttggtagcagtggttccgaaaagctgctc
tgccccagaggcagaacgttgcaggaaaccatgccatgcacgggacagaacgcagcgaca
ccgcccagcacagaccccggtttgacgggaggcactgtgagccagtttcccccgctgtat
atgcctggcctagagtacccgaattcagctgcccattaccacatcagtccaggcctgcag
ggtgtgggccctgtgatgggagggaagtccccagcatcccatccccagcattttccccca
aggggctttcagtctaaccacccacattctggaggctttccccggtatcgccccccacaa
ggaatgaggtattcctaccacccaccgccacagccttcctaccaccactatcagcgaact
ccttactatgcctgtccacagagcttttctgactggcagagacctctccatccccaggga
agcccaagcggacccccagccagtcagcctcccccaccaaggtccctcttctcagataag
aatgccatggccagtctgcaaggctgtgagacactgaatgctgccttaacttctccaacc
cgtatggatgcagtggctgctaaagtcccaaatgacgggcagaatcctggtccagaggaa
gagaagctggatgaatctatggagaggccagagagtcccaaagaatttttagacctggac
aaccataacgcagctaccaagcggcagagctcgttgtcagccagcgagtatctctatgga
actcctccgcctctgagttcaggaatgggatttggttcatctgcatttccaccccacagt
gtgatgctgcagacggggcctccctatacccctcagcggccggccagtcactttcagccc
agggcttactcttcccctgtggctgccctcccacctcaccacccaggggccacccagccc
aacggcctctctcaggagggtcccatctatcgctgccaggaagaaggcctgggtcacttt
caagctgtgatgatggaacaaattggcactagaagtggaataagaggacctttccaggaa
atgtacagaccatcaggaatgcagatgcacccggtccagtcgcaggcctcgttcccaaag
acccccacagcagcaacatcacaggaggaggtgccgcctcataagcctccaacacttccc
ctggatcagagctag

DBGET integrated database retrieval system