KEGG   Homo sapiens (human): 2746Help
Entry
2746              CDS       T01001                                 

Gene name
GLUD1, GDH, GDH1, GLUD
Definition
(RefSeq) glutamate dehydrogenase 1
  KO
K00261  glutamate dehydrogenase (NAD(P)+) [EC:1.4.1.3]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00220  Arginine biosynthesis
hsa00250  Alanine, aspartate and glutamate metabolism
hsa00471  D-Glutamine and D-glutamate metabolism
hsa00910  Nitrogen metabolism
hsa01100  Metabolic pathways
hsa01200  Carbon metabolism
hsa04217  Necroptosis
hsa04964  Proximal tubule bicarbonate reclamation
Disease
H01267  Familial hyperinsulinemic hypoglycemia
H01400  Secondary hyperammonemia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    2746 (GLUD1)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    2746 (GLUD1)
   00220 Arginine biosynthesis
    2746 (GLUD1)
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    2746 (GLUD1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    2746 (GLUD1)
 09150 Organismal Systems
  09155 Excretory system
   04964 Proximal tubule bicarbonate reclamation
    2746 (GLUD1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    2746 (GLUD1)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.3  glutamate dehydrogenase [NAD(P)+]
     2746 (GLUD1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   2746 (GLUD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ELFV_dehydrog_N ELFV_dehydrog 2-Hacid_dh_C
Motif
Other DBs
NCBI-GeneID: 2746
NCBI-ProteinID: NP_005262
OMIM: 138130
HGNC: 4335
Ensembl: ENSG00000148672
Vega: OTTHUMG00000018666
Pharos: P00367(Tbio)
UniProt: P00367 E9KL48
Structure
PDB: 

Position
10q23.2
AA seq 558 aa AA seqDB search
MYRYLGEALLLSRAGPAALGSASADSAALLGWARGQPAAAPQPGLALAARRHYSEAVADR
EDDPNFFKMVEGFFDRGASIVEDKLVEDLRTRESEEQKRNRVRGILRIIKPCNHVLSLSF
PIRRDDGSWEVIEGYRAQHSQHRTPCKGGIRYSTDVSVDEVKALASLMTYKCAVVDVPFG
GAKAGVKINPKNYTDNELEKITRRFTMELAKKGFIGPGIDVPAPDMSTGEREMSWIADTY
ASTIGHYDINAHACVTGKPISQGGIHGRISATGRGVFHGIENFINEASYMSILGMTPGFG
DKTFVVQGFGNVGLHSMRYLHRFGAKCIAVGESDGSIWNPDGIDPKELEDFKLQHGSILG
FPKAKPYEGSILEADCDILIPAASEKQLTKSNAPRVKAKIIAEGANGPTTPEADKIFLER
NIMVIPDLYLNAGGVTVSYFEWLKNLNHVSYGRLTFKYERDSNYHLLMSVQESLERKFGK
HGGTIPIVPTAEFQDRISGASEKDIVHSGLAYTMERSARQIMRTAMKYNLGLDLRTAAYV
NAIEKVFKVYNEAGVTFT
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
atgtaccgctacctgggcgaagcgctgttgctgtcccgggccgggcccgctgccctgggc
tcggcgtccgccgactcggccgcgttgctgggctgggcccggggacagcccgccgccgcc
ccgcagccggggctggcattggccgcccggcgccactacagcgaggcggtggccgaccgc
gaggacgaccccaacttcttcaagatggtggagggcttcttcgatcgcggcgccagcatc
gtggaggacaagctggtggaggacctgaggacccgggagagcgaggagcagaagcggaac
cgggtgcgcggcatcctgcggatcatcaagccctgcaaccatgtgctgagtctctccttc
cccatccggcgcgacgacggctcctgggaggtcatcgaaggctaccgggcccagcacagc
cagcaccgcacgccctgcaagggaggtatccgttacagcactgatgtgagtgtagatgaa
gtaaaagctttggcttctctgatgacatacaagtgtgcagtggttgatgtgccgtttggg
ggtgctaaagctggtgttaagatcaatcccaagaactatactgataatgaattggaaaag
atcacaaggaggttcaccatggagctagcaaaaaagggctttattggtcctggcattgat
gtgcctgctccagacatgagcacaggtgagcgggagatgtcctggatcgctgatacctat
gccagcaccatagggcactatgatattaatgcacacgcctgtgttactggtaaacccatc
agccaagggggaatccatggacgcatctctgctactggccgtggtgtcttccatgggatt
gaaaatttcatcaatgaagcttcttacatgagcattttaggaatgacaccagggtttgga
gataaaacatttgttgttcagggatttggtaatgtgggcctacactctatgagatattta
catcgttttggtgctaaatgtattgctgttggtgagtctgatgggagtatatggaatcca
gatggtattgacccaaaggaactggaagacttcaaattgcaacatgggtccattctgggc
ttccccaaggcaaagccctatgaaggaagcatcttggaggccgactgtgacatactgatc
ccagctgccagtgagaagcagttgaccaaatccaacgcacccagagtcaaagccaagatc
attgctgaaggtgccaatgggccaacaactccagaagctgacaagatcttcctggagaga
aacattatggttattccagatctctacttgaatgctggaggagtgacagtatcttacttt
gagtggctgaagaatctaaatcatgtcagctatggccgtttgaccttcaaatatgaaagg
gattctaactaccacttgctcatgtctgttcaagagagtttagaaagaaaatttggaaag
catggtggaactattcccattgtacccacggcagagttccaagacaggatatcgggtgca
tctgagaaagacatcgtgcactctggcttggcatacacaatggagcgttctgccaggcaa
attatgcgcacagccatgaagtataacctgggattggacctgagaacagctgcctatgtt
aatgccattgagaaagtcttcaaagtgtacaatgaagctggtgtgaccttcacatag

KEGG   Homo sapiens (human): 2747Help
Entry
2747              CDS       T01001                                 

Gene name
GLUD2, GDH2, GLUDP1
Definition
(RefSeq) glutamate dehydrogenase 2
  KO
K00261  glutamate dehydrogenase (NAD(P)+) [EC:1.4.1.3]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00220  Arginine biosynthesis
hsa00250  Alanine, aspartate and glutamate metabolism
hsa00471  D-Glutamine and D-glutamate metabolism
hsa00910  Nitrogen metabolism
hsa01100  Metabolic pathways
hsa01200  Carbon metabolism
hsa04217  Necroptosis
hsa04964  Proximal tubule bicarbonate reclamation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    2747 (GLUD2)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    2747 (GLUD2)
   00220 Arginine biosynthesis
    2747 (GLUD2)
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    2747 (GLUD2)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    2747 (GLUD2)
 09150 Organismal Systems
  09155 Excretory system
   04964 Proximal tubule bicarbonate reclamation
    2747 (GLUD2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    2747 (GLUD2)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.3  glutamate dehydrogenase [NAD(P)+]
     2747 (GLUD2)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   2747 (GLUD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ELFV_dehydrog_N ELFV_dehydrog 2-Hacid_dh_C
Motif
Other DBs
NCBI-GeneID: 2747
NCBI-ProteinID: NP_036216
OMIM: 300144
HGNC: 4336
Ensembl: ENSG00000182890
Vega: OTTHUMG00000022320
Pharos: P49448(Tbio)
UniProt: P49448 A0A140VK14
Structure
PDB: 

Position
Xq24
AA seq 558 aa AA seqDB search
MYRYLAKALLPSRAGPAALGSAANHSAALLGRGRGQPAAASQPGLALAARRHYSELVADR
EDDPNFFKMVEGFFDRGASIVEDKLVKDLRTQESEEQKRNRVRGILRIIKPCNHVLSLSF
PIRRDDGSWEVIEGYRAQHSQHRTPCKGGIRYSTDVSVDEVKALASLMTYKCAVVDVPFG
GAKAGVKINPKNYTENELEKITRRFTMELAKKGFIGPGVDVPAPDMNTGEREMSWIADTY
ASTIGHYDINAHACVTGKPISQGGIHGRISATGRGVFHGIENFINEASYMSILGMTPGFR
DKTFVVQGFGNVGLHSMRYLHRFGAKCIAVGESDGSIWNPDGIDPKELEDFKLQHGSILG
FPKAKPYEGSILEVDCDILIPAATEKQLTKSNAPRVKAKIIAEGANGPTTPEADKIFLER
NILVIPDLYLNAGGVTVSYFEWLKNLNHVSYGRLTFKYERDSNYHLLLSVQESLERKFGK
HGGTIPIVPTAEFQDSISGASEKDIVHSALAYTMERSARQIMHTAMKYNLGLDLRTAAYV
NAIEKVFKVYSEAGVTFT
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
atgtaccgctacctggccaaagcgctgctgccgtcccgggccgggcccgctgccctgggc
tccgcggccaaccactcggccgcgttgctgggccggggccgcggacagcccgccgccgcc
tcgcagccggggctcgcattggccgcccggcgccactacagcgagttggtggccgaccgc
gaggacgaccccaacttcttcaagatggtggagggcttcttcgatcgcggcgccagcatc
gtggaggacaagttggtgaaggacctgaggacccaggaaagcgaggagcagaagcggaac
cgggtgcgcggcatcctgcggatcatcaagccctgcaaccatgtgctgagtctctccttc
cccatccggcgcgacgacggctcctgggaggtcatcgaaggctaccgggcccagcacagc
cagcaccgcacgccctgcaagggaggtatccgttacagcactgatgtgagtgtagatgaa
gtaaaagctttggcttctctgatgacatacaagtgtgcagtggttgatgtgccgtttggg
ggtgctaaagctggtgttaagatcaatcccaagaactataccgaaaatgaattggaaaag
atcacaaggaggttcaccatggagctagcaaagaagggctttattggtcctggcgttgat
gtgcctgctccagacatgaacacaggtgagcgggagatgtcctggattgctgatacctat
gccagcaccatagggcactatgatattaatgcacacgcctgtgttactggtaaacccatc
agccaagggggaatccatggacgcatctctgctactggccgtggtgtcttccatgggatt
gaaaacttcatcaatgaagcttcttacatgagcattttaggaatgacaccagggtttaga
gataaaacatttgttgttcagggatttggtaatgtgggcctacactctatgagatattta
catcgttttggtgctaaatgtattgctgttggtgagtctgatgggagtatatggaatcca
gatggtattgacccaaaggaactggaagacttcaaattgcaacatgggtccattctgggc
ttccccaaggcaaagccctatgaaggaagcatcttggaggtcgactgtgacatactgatc
ccagctgccactgagaagcagttgaccaaatccaacgcacccagagtcaaagccaagatc
attgctgaaggtgccaatgggccaacaactccagaagctgataagatcttcctggagaga
aacattttggttattccagatctctacttgaatgctggaggagtgacagtatcttacttt
gagtggctgaagaatctaaatcatgtcagctatggccgtttgaccttcaaatatgaaagg
gattctaactaccacttgctcctgtctgttcaagagagtttagaaagaaaatttggaaag
catggtggaactattcccattgtacccacggcagagttccaagacagtatatcgggtgca
tctgagaaagacattgtgcactctgccttggcatacacaatggagcgttctgccaggcaa
attatgcacacagccatgaagtataacctgggattggacctgagaacagctgcctatgtc
aatgccattgaaaaagtcttcaaagtgtacagtgaagctggtgtgaccttcacatag

DBGET integrated database retrieval system