KEGG   Homo sapiens (human): 2762Help
Entry
2762              CDS       T01001                                 

Gene name
GMDS, GMD, SDR3E1
Definition
(RefSeq) GDP-mannose 4,6-dehydratase
  KO
K01711  GDPmannose 4,6-dehydratase [EC:4.2.1.47]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00051  Fructose and mannose metabolism
hsa00520  Amino sugar and nucleotide sugar metabolism
hsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    2762 (GMDS)
   00520 Amino sugar and nucleotide sugar metabolism
    2762 (GMDS)
Enzymes [BR:hsa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.47  GDP-mannose 4,6-dehydratase
     2762 (GMDS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GDP_Man_Dehyd Epimerase RmlD_sub_bind NmrA Polysacc_synt_2
Motif
Other DBs
NCBI-GeneID: 2762
NCBI-ProteinID: NP_001491
OMIM: 602884
HGNC: 4369
Ensembl: ENSG00000112699
Vega: OTTHUMG00000016143
Pharos: O60547(Tbio)
UniProt: O60547
Structure
PDB: 

Position
6p25.3
AA seq 372 aa AA seqDB search
MAHAPARCPSARGSGDGEMGKPRNVALITGITGQDGSYLAEFLLEKGYEVHGIVRRSSSF
NTGRIEHLYKNPQAHIEGNMKLHYGDLTDSTCLVKIINEVKPTEIYNLGAQSHVKISFDL
AEYTADVDGVGTLRLLDAVKTCGLINSVKFYQASTSELYGKVQEIPQKETTPFYPRSPYG
AAKLYAYWIVVNFREAYNLFAVNGILFNHESPRRGANFVTRKISRSVAKIYLGQLECFSL
GNLDAKRDWGHAKDYVEAMWLMLQNDEPEDFVIATGEVHSVREFVEKSFLHIGKTIVWEG
KNENEVGRCKETGKVHVTVDLKYYRPTEVDFLQGDCTKAKQKLNWKPRVAFDELVREMVH
ADVELMRTNPNA
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atggcacacgcaccggcacgctgccccagcgcccggggctccggggacggcgagatgggc
aagcccaggaacgtggcgctcatcaccggtatcacaggccaggatggttcctacctggct
gagttcctgctggagaaaggctatgaggtccatggaattgtacggcggtccagttcattt
aatacgggtcgaattgagcatctgtataagaatccccaggctcacattgaaggaaacatg
aagttgcactatggcgatctcactgacagtacctgccttgtgaagatcattaatgaagta
aagcccacagagatctacaaccttggagcccagagccacgtcaaaatttcctttgacctc
gctgagtacactgcggacgttgacggagttggcactctacgacttctagatgcagttaag
acttgtggccttatcaactctgtgaagttctaccaagcctcaacaagtgaactttatggg
aaagtgcaggaaataccccagaaggagaccacccctttctatccccggtcaccctatggg
gcagcaaaactctatgcctattggattgtggtgaacttccgtgaggcgtataatctcttt
gcagtgaacggcattctcttcaatcatgagagtcccagaagaggagctaatttcgttact
cgaaaaattagccggtcagtagctaagatttaccttggacaactggaatgtttcagtttg
ggaaatctggatgccaaacgagattggggccatgccaaggactatgtggaggctatgtgg
ttgatgttgcagaatgatgagccggaggacttcgttatagctactggggaggtccatagt
gtccgggaatttgtcgagaaatcattcttgcacattggaaaaaccattgtgtgggaagga
aagaatgaaaatgaagtgggcagatgtaaagagaccggcaaagttcacgtgactgtggat
ctcaagtactaccggccaactgaagtggactttctgcagggcgactgcaccaaagcgaaa
cagaagctgaactggaagccccgggtcgctttcgatgagctggtgagggagatggtgcac
gccgacgtggagctcatgaggacaaaccccaatgcctga

DBGET integrated database retrieval system