KEGG   Homo sapiens (human): 2764
Entry
2764              CDS       T01001                                 

Gene name
GMFB, GMF
Definition
(RefSeq) glia maturation factor beta
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: Cofilin_ADF
Other DBs
NCBI-GeneID: 2764
NCBI-ProteinID: NP_004115
OMIM: 601713
HGNC: 4373
Ensembl: ENSG00000197045
Vega: OTTHUMG00000140307
Pharos: P60983(Tbio)
UniProt: P60983
Position
14q22.2
AA seq 142 aa
MSESLVVCDVAEDLVEKLRKFRFRKETNNAAIIMKIDKDKRLVVLDEELEGISPDELKDE
LPERQPRFIVYSYKYQHDDGRVSYPLCFIFSSPVGCKPEQQMMYAGSKNKLVQTAELTKV
FEIRNTEDLTEEWLREKLGFFH
NT seq 429 nt   +upstreamnt  +downstreamnt
atgagtgagtctttggttgtttgtgatgttgccgaagatttagtggaaaagctgagaaag
tttcgttttcgcaaagaaacgaacaacgctgctattataatgaagattgacaaggataaa
cgcctggtggtactggatgaggagcttgagggcatttcaccagatgaacttaaagatgaa
ctacctgaacgacaacctcgcttcattgtgtatagttataaatatcaacatgatgatgga
agagtttcatatcctctgtgctttattttctccagtcctgttggatgtaagcctgaacaa
cagatgatgtatgctggaagtaagaataagctagtccagacagctgaactaaccaaggta
tttgaaataagaaataccgaagacctaactgaagaatggttacgtgagaaacttggattt
tttcactaa

DBGET integrated database retrieval system