KEGG   Homo sapiens (human): 2766Help
Entry
2766              CDS       T01001                                 

Gene name
GMPR, GMPR_1, GMPR1
Definition
(RefSeq) guanosine monophosphate reductase
  KO
K00364  GMP reductase [EC:1.7.1.7]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00230  Purine metabolism
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    2766 (GMPR)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.1  With NAD+ or NADP+ as acceptor
    1.7.1.7  GMP reductase
     2766 (GMPR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IMPDH FMN_dh Aldolase QRPTase_C Glu_synthase
Motif
Other DBs
NCBI-GeneID: 2766
NCBI-ProteinID: NP_006868
OMIM: 139265
HGNC: 4376
Ensembl: ENSG00000137198
Vega: OTTHUMG00000014302
Pharos: P36959(Tbio)
UniProt: P36959
Structure
PDB: 

Position
6p22.3
AA seq 345 aa AA seqDB search
MPRIDADLKLDFKDVLLRPKRSSLKSRAEVDLERTFTFRNSKQTYSGIPIIVANMDTVGT
FEMAAVMSQHSMFTAIHKHYSLDDWKLFATNHPECLQNVAVSSGSGQNDLEKMTSILEAV
PQVKFICLDVANGYSEHFVEFVKLVRAKFPEHTIMAGNVVTGEMVEELILSGADIIKVGV
GPGSVCTTRTKTGVGYPQLSAVIECADSAHGLKGHIISDGGCTCPGDVAKAFGAGADFVM
LGGMFSGHTECAGEVFERNGRKLKLFYGMSSDTAMNKHAGGVAEYRASEGKTVEVPYKGD
VENTILDILGGLRSTCTYVGAAKLKELSRRATFIRVTQQHNTVFS
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgccccgcatagatgcggacctcaagctcgacttcaaggatgtcctgctccgacctaag
cggagcagcctcaagagccgagccgaggtggatcttgaacgcaccttcacgtttcgaaat
tcaaagcagacctactcagggattcccatcatcgtggccaacatggacactgtgggcacg
tttgagatggcagccgtgatgtcacagcactccatgtttacagcaattcataagcattac
tccctggatgactggaagctctttgccacaaatcacccagaatgcctgcagaatgtagcc
gtgagttcaggcagtgggcagaatgatctggaaaagatgaccagcatcctggaagctgtg
ccacaggttaagtttatttgcctggatgtggccaatgggtattcagaacattttgtggaa
ttcgtgaaacttgtccgtgccaaatttcctgaacacaccattatggcagggaacgtggtg
acaggagaaatggtagaagagcttattctttccggagcagatatcatcaaagtgggagtt
ggaccaggttctgtgtgcaccacccgcaccaagacgggagtggggtacccccagctgagt
gccgtcattgagtgtgccgactctgcccatggcctgaagggccacatcatctctgatgga
ggctgtacgtgtccaggggatgtcgccaaagcctttggagctggagcagattttgtcatg
ctgggaggaatgttttcgggtcatacggagtgtgctggagaagtgtttgagaggaacgga
cggaagctcaagctcttctacgggatgagctctgacaccgccatgaacaagcacgcagga
ggagttgctgagtacagagcctctgagggtaagactgtggaagttccttacaaaggagat
gtggaaaacactatcctggatattctcgggggactgaggtccacgtgcacctacgtgggg
gccgccaaactcaaggagctcagcaggagggcaacattcatccgggtgacccagcagcac
aacaccgtgttcagctaa

DBGET integrated database retrieval system