KEGG   Homo sapiens (human): 2768Help
Entry
2768              CDS       T01001                                 

Gene name
GNA12, NNX3, RMP, gep
Definition
(RefSeq) G protein subunit alpha 12
  KO
K04346  guanine nucleotide-binding protein subunit alpha-12
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04022  cGMP-PKG signaling pathway
hsa04071  Sphingolipid signaling pathway
hsa04072  Phospholipase D signaling pathway
hsa04270  Vascular smooth muscle contraction
hsa04730  Long-term depression
hsa04810  Regulation of actin cytoskeleton
hsa04928  Parathyroid hormone synthesis, secretion and action
hsa05163  Human cytomegalovirus infection
hsa05200  Pathways in cancer
Network
N00405  CXCR4-GNA12/13-Rho signaling pathway
N00406  HCMV US28 to GNA12/13-Rho signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    2768 (GNA12)
   04072 Phospholipase D signaling pathway
    2768 (GNA12)
   04071 Sphingolipid signaling pathway
    2768 (GNA12)
   04022 cGMP-PKG signaling pathway
    2768 (GNA12)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    2768 (GNA12)
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    2768 (GNA12)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    2768 (GNA12)
  09156 Nervous system
   04730 Long-term depression
    2768 (GNA12)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    2768 (GNA12)
  09172 Infectious diseases: Viral
   05163 Human cytomegalovirus infection
    2768 (GNA12)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    2768 (GNA12)
   04031 GTP-binding proteins [BR:hsa04031]
    2768 (GNA12)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of hepatic cells
   2768 (GNA12)
GTP-binding proteins [BR:hsa04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 4 (G12/13)
    2768 (GNA12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G-alpha Arf Gtr1_RagA GTP_EFTU FtsK_SpoIIIE
Motif
Other DBs
NCBI-GeneID: 2768
NCBI-ProteinID: NP_031379
OMIM: 604394
HGNC: 4380
Ensembl: ENSG00000146535
Vega: OTTHUMG00000023064
Pharos: Q03113(Tbio)
UniProt: Q03113 Q6ZQV4
Position
7p22.3-p22.2
AA seq 381 aa AA seqDB search
MSGVVRTLSRCLLPAEAGGARERRAGSGARDAEREARRRSRDIDALLARERRAVRRLVKI
LLLGAGESGKSTFLKQMRIIHGREFDQKALLEFRDTIFDNILKGSRVLVDARDKLGIPWQ
YSENEKHGMFLMAFENKAGLPVEPATFQLYVPALSALWRDSGIREAFSRRSEFQLGESVK
YFLDNLDRIGQLNYFPSKQDILLARKATKGIVEHDFVIKKIPFKMVDVGGQRSQRQKWFQ
CFDGITSILFMVSSSEYDQVLMEDRRTNRLVESMNIFETIVNNKLFFNVSIILFLNKMDL
LVEKVKTVSIKKHFPDFRGDPHRLEDVQRYLVQCFDRKRRNRSKPLFHHFTTAIDTENVR
FVFHAVKDTILQENLKDIMLQ
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgtccggggtggtgcggaccctcagccgctgcctgctgccggccgaggccggcggggcc
cgcgagcgcagggcgggcagcggcgcgcgcgacgcggagcgcgaggcccggaggcgtagc
cgcgacatcgacgcgctgctggcccgcgagcggcgcgcggtccggcgcctggtgaagatc
ctgctgctgggcgcgggcgagagcggcaagtccacgttcctcaagcagatgcgcatcatc
cacggccgcgagttcgaccagaaggcgctgctggagttccgcgacaccatcttcgacaac
atcctcaagggctcaagggttcttgttgatgcacgagataagcttggcattccttggcag
tattctgaaaatgagaagcatgggatgttcctgatggccttcgagaacaaggcggggctg
cctgtggagccggccaccttccagctgtacgtcccggccctgagcgcactctggagggat
tctggcatcagggaggctttcagccggagaagcgagtttcagctgggggagtcggtgaag
tacttcctggacaacttggaccggatcggccagctgaattactttcctagtaagcaagat
atcctgctggctaggaaagccaccaagggaattgtggagcatgacttcgttattaagaag
atcccctttaagatggtggatgtgggcggccagcggtcccagcgccagaagtggttccag
tgcttcgacgggatcacgtccatcctgttcatggtctcctccagcgagtacgaccaggtc
ctcatggaggacaggcgcaccaaccggctggtggagtccatgaacatcttcgagaccatc
gtcaacaacaagctcttcttcaacgtctccatcattctcttcctcaacaagatggacctc
ctggtggagaaggtgaagaccgtgagcatcaagaagcacttcccggacttcaggggcgac
ccgcacaggctggaggacgtccagcgctacctggtccagtgcttcgacaggaagagacgg
aaccgcagcaagccactcttccaccacttcaccaccgccatcgacaccgagaacgtccgc
ttcgtgttccatgctgtgaaagacaccatcctgcaggagaacctgaaggacatcatgctg
cagtga

KEGG   Homo sapiens (human): 55970Help
Entry
55970             CDS       T01001                                 

Gene name
GNG12
Definition
(RefSeq) G protein subunit gamma 12
  KO
K04347  guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-12
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04014  Ras signaling pathway
hsa04062  Chemokine signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04371  Apelin signaling pathway
hsa04713  Circadian entrainment
hsa04723  Retrograde endocannabinoid signaling
hsa04724  Glutamatergic synapse
hsa04725  Cholinergic synapse
hsa04726  Serotonergic synapse
hsa04727  GABAergic synapse
hsa04728  Dopaminergic synapse
hsa04810  Regulation of actin cytoskeleton
hsa04926  Relaxin signaling pathway
hsa05032  Morphine addiction
hsa05034  Alcoholism
hsa05163  Human cytomegalovirus infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05200  Pathways in cancer
Network
N00152  CXCR-GNB/G-ERK signaling pathway
N00153  CXCR-GNB/G-PI3K-RAC signaling pathway
N00154  CXCR-GNB/G-PI3K-AKT signaling pathway
N00157  KSHV vGPCR to GNB/G-ERK signaling pathway
N00158  KSHV vGPCR to GNB/G-PI3K-AKT signaling pathway
N00178  KSHV vGPCR to GNB/G-PI3K-JNK signaling pathway
N00399  CCR2-GNB/G-PI3K-NFKB signaling pathway
N00400  HCMV US28 to GNB/G-PI3K-NFKB signaling pathway
N00408  LPAR-GNB/G-Rho signaling pathway
N00409  HCMV UL33 to GNB/G-Rho signaling pathway
N00413  CXCR4-GNB/G-PLCB-PKC signaling pathway
N00428  CCR5-GNB/G-PLCB/G-PKC signaling pathway
N00433  CXCR4-GNB/G-RAC signaling pathway
N00434  HIV gp120 to CXCR4-GNB/G-RAC signaling pathway
 » show all
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    55970 (GNG12)
   04010 MAPK signaling pathway
    55970 (GNG12)
   04371 Apelin signaling pathway
    55970 (GNG12)
   04151 PI3K-Akt signaling pathway
    55970 (GNG12)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    55970 (GNG12)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    55970 (GNG12)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    55970 (GNG12)
  09156 Nervous system
   04724 Glutamatergic synapse
    55970 (GNG12)
   04727 GABAergic synapse
    55970 (GNG12)
   04725 Cholinergic synapse
    55970 (GNG12)
   04728 Dopaminergic synapse
    55970 (GNG12)
   04726 Serotonergic synapse
    55970 (GNG12)
   04723 Retrograde endocannabinoid signaling
    55970 (GNG12)
  09159 Environmental adaptation
   04713 Circadian entrainment
    55970 (GNG12)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    55970 (GNG12)
  09165 Substance dependence
   05032 Morphine addiction
    55970 (GNG12)
   05034 Alcoholism
    55970 (GNG12)
  09172 Infectious diseases: Viral
   05170 Human immunodeficiency virus 1 infection
    55970 (GNG12)
   05163 Human cytomegalovirus infection
    55970 (GNG12)
   05167 Kaposi sarcoma-associated herpesvirus infection
    55970 (GNG12)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    55970 (GNG12)
   04031 GTP-binding proteins [BR:hsa04031]
    55970 (GNG12)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   55970 (GNG12)
  Exosomal proteins of colorectal cancer cells
   55970 (GNG12)
GTP-binding proteins [BR:hsa04031]
 Heterotrimeric G-proteins
  Gamma Subunits
   Gamma [OT]
    55970 (GNG12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G-gamma CP12
Motif
Other DBs
NCBI-GeneID: 55970
NCBI-ProteinID: NP_061329
OMIM: 615405
HGNC: 19663
Ensembl: ENSG00000172380
Vega: OTTHUMG00000009545
Pharos: Q9UBI6(Tbio)
UniProt: Q9UBI6
Position
1p31.3
AA seq 72 aa AA seqDB search
MSSKTASTNNIAQARRTVQQLRLEASIERIKVSKASADLMSYCEEHARSDPLLIGIPTSE
NPFKDKKTCIIL
NT seq 219 nt NT seq  +upstreamnt  +downstreamnt
atgtccagcaaaacagcaagcaccaacaatatagcccaggcaaggagaactgtgcagcag
ttaagattagaagcctccattgaaagaataaaggtttcgaaggcatcagcggacctcatg
tcctactgtgaggaacatgccaggagtgaccctttgctgataggaataccaacttcagaa
aaccctttcaaggataaaaaaacttgcatcatcttatag

DBGET integrated database retrieval system