KEGG   Homo sapiens (human): 2770Help
Entry
2770              CDS       T01001                                 

Gene name
GNAI1, Gi
Definition
(RefSeq) G protein subunit alpha i1
  KO
K04630  guanine nucleotide-binding protein G(i) subunit alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa04015  Rap1 signaling pathway
hsa04022  cGMP-PKG signaling pathway
hsa04024  cAMP signaling pathway
hsa04062  Chemokine signaling pathway
hsa04071  Sphingolipid signaling pathway
hsa04261  Adrenergic signaling in cardiomyocytes
hsa04360  Axon guidance
hsa04371  Apelin signaling pathway
hsa04540  Gap junction
hsa04611  Platelet activation
hsa04670  Leukocyte transendothelial migration
hsa04713  Circadian entrainment
hsa04723  Retrograde endocannabinoid signaling
hsa04724  Glutamatergic synapse
hsa04725  Cholinergic synapse
hsa04726  Serotonergic synapse
hsa04727  GABAergic synapse
hsa04728  Dopaminergic synapse
hsa04730  Long-term depression
hsa04914  Progesterone-mediated oocyte maturation
hsa04915  Estrogen signaling pathway
hsa04916  Melanogenesis
hsa04921  Oxytocin signaling pathway
hsa04923  Regulation of lipolysis in adipocytes
hsa04924  Renin secretion
hsa04926  Relaxin signaling pathway
hsa04928  Parathyroid hormone synthesis, secretion and action
hsa04934  Cushing syndrome
hsa04971  Gastric acid secretion
hsa05012  Parkinson disease
hsa05030  Cocaine addiction
hsa05032  Morphine addiction
hsa05034  Alcoholism
hsa05133  Pertussis
hsa05142  Chagas disease (American trypanosomiasis)
hsa05145  Toxoplasmosis
hsa05163  Human cytomegalovirus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05200  Pathways in cancer
Network
nt06124  Chemokine signaling (viruses)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06167  Human cytomegalovirus (HCMV)
nt06310  CRH-ACTH-cortisol signaling
nt06360  Cushing syndrome
  Element
N00325  Mutation-inactivated RASD1 to CRHR-PKA-ACTH signaling pathway
N00403  CX3CR1-GNAI-AC-PKA signaling pathway
N00404  HCMV US28 to GNAI-AC-PKA signaling pathway
N00412  HCMV UL33 to GNAI-AC-PKA signaling pathway
N00430  CXCR4-GNAI-PI3K-BAD signaling pathway
N00431  HIV gp120 to CXCR4-GNAI-PI3K-BAD signaling pathway
N00879  PROK-PRKR-Gi-ERK signaling pathway
N00880  Mutation-inactivated PROK2 to PROK-PRKR-Gi-ERK signaling pathway
N00881  Mutation-inactivated PROKR2 to PROK-PRKR-Gi-ERK signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    2770 (GNAI1)
   04371 Apelin signaling pathway
    2770 (GNAI1)
   04071 Sphingolipid signaling pathway
    2770 (GNAI1)
   04024 cAMP signaling pathway
    2770 (GNAI1)
   04022 cGMP-PKG signaling pathway
    2770 (GNAI1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    2770 (GNAI1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    2770 (GNAI1)
   04670 Leukocyte transendothelial migration
    2770 (GNAI1)
   04062 Chemokine signaling pathway
    2770 (GNAI1)
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    2770 (GNAI1)
   04915 Estrogen signaling pathway
    2770 (GNAI1)
   04914 Progesterone-mediated oocyte maturation
    2770 (GNAI1)
   04921 Oxytocin signaling pathway
    2770 (GNAI1)
   04926 Relaxin signaling pathway
    2770 (GNAI1)
   04928 Parathyroid hormone synthesis, secretion and action
    2770 (GNAI1)
   04916 Melanogenesis
    2770 (GNAI1)
   04924 Renin secretion
    2770 (GNAI1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    2770 (GNAI1)
  09154 Digestive system
   04971 Gastric acid secretion
    2770 (GNAI1)
  09156 Nervous system
   04724 Glutamatergic synapse
    2770 (GNAI1)
   04727 GABAergic synapse
    2770 (GNAI1)
   04725 Cholinergic synapse
    2770 (GNAI1)
   04728 Dopaminergic synapse
    2770 (GNAI1)
   04726 Serotonergic synapse
    2770 (GNAI1)
   04730 Long-term depression
    2770 (GNAI1)
   04723 Retrograde endocannabinoid signaling
    2770 (GNAI1)
  09158 Development and regeneration
   04360 Axon guidance
    2770 (GNAI1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    2770 (GNAI1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    2770 (GNAI1)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    2770 (GNAI1)
  09165 Substance dependence
   05030 Cocaine addiction
    2770 (GNAI1)
   05032 Morphine addiction
    2770 (GNAI1)
   05034 Alcoholism
    2770 (GNAI1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    2770 (GNAI1)
  09171 Infectious disease: bacterial
   05133 Pertussis
    2770 (GNAI1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    2770 (GNAI1)
   05163 Human cytomegalovirus infection
    2770 (GNAI1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    2770 (GNAI1)
   05142 Chagas disease (American trypanosomiasis)
    2770 (GNAI1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    2770 (GNAI1)
   04031 GTP-binding proteins [BR:hsa04031]
    2770 (GNAI1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Proteins found in most exosomes
   2770 (GNAI1)
GTP-binding proteins [BR:hsa04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 1 (Gi/o) [OT]
    2770 (GNAI1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G-alpha Arf Gtr1_RagA Roc TniB AAA_16 AAA_29 FtsK_SpoIIIE
Motif
Other DBs
NCBI-GeneID: 2770
NCBI-ProteinID: NP_002060
OMIM: 139310
HGNC: 4384
Ensembl: ENSG00000127955
Vega: OTTHUMG00000023523
Pharos: P63096(Tbio)
UniProt: P63096
Structure
PDB: 

Position
7q21.11
AA seq 354 aa AA seqDB search
MGCTLSAEDKAAVERSKMIDRNLREDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEAG
YSEEECKQYKAVVYSNTIQSIIAIIRAMGRLKIDFGDSARADDARQLFVLAGAAEEGFMT
AELAGVIKRLWKDSGVQACFNRSREYQLNDSAAYYLNDLDRIAQPNYIPTQQDVLRTRVK
TTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEM
NRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKIKKSPLTICYPEYAGSNTYEEAA
AYIQCQFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKDCGLF
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgggctgcacgctgagcgccgaggacaaggcggcggtggagcggagtaagatgatcgac
cgcaacctccgtgaggacggcgagaaggcggcgcgcgaggtcaagctgctgctgctcggt
gctggtgaatctggtaaaagtacaattgtgaagcagatgaaaattatccatgaagctggt
tattcagaagaggagtgtaaacaatacaaagcagtggtctacagtaacaccatccagtca
attattgctatcattagggctatggggaggttgaagatagactttggtgactcagcccgg
gcggatgatgcacgccaactctttgtgctagctggagctgctgaagaaggctttatgact
gcagaacttgctggagttataaagagattgtggaaagatagtggtgtacaagcctgtttc
aacagatcccgagagtaccagcttaatgattctgcagcatactatttgaatgacttggac
agaatagctcaaccaaattacatcccgactcaacaagatgttctcagaactagagtgaaa
actacaggaattgttgaaacccattttactttcaaagatcttcattttaaaatgtttgat
gtgggaggtcagagatctgagcggaagaagtggattcattgcttcgaaggagtgacggcg
atcatcttctgtgtagcactgagtgactacgacctggttctagctgaagatgaagaaatg
aaccgaatgcatgaaagcatgaaattgtttgacagcatatgtaacaacaagtggtttaca
gatacatccattatactttttctaaacaagaaggatctctttgaagaaaaaatcaaaaag
agccctctcactatatgctatccagaatatgcaggatcaaacacatatgaagaggcagct
gcatatattcaatgtcagtttgaagacctcaataaaagaaaggacacaaaggaaatatac
acccacttcacatgtgccacagatactaagaatgtgcagtttgtttttgatgctgtaaca
gatgtcatcataaaaaataatctaaaagattgtggtctcttttaa

KEGG   Homo sapiens (human): 2771Help
Entry
2771              CDS       T01001                                 

Gene name
GNAI2, GIP, GNAI2B, H_LUCA15.1, H_LUCA16.1
Definition
(RefSeq) G protein subunit alpha i2
  KO
K04630  guanine nucleotide-binding protein G(i) subunit alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa04015  Rap1 signaling pathway
hsa04022  cGMP-PKG signaling pathway
hsa04024  cAMP signaling pathway
hsa04062  Chemokine signaling pathway
hsa04071  Sphingolipid signaling pathway
hsa04261  Adrenergic signaling in cardiomyocytes
hsa04360  Axon guidance
hsa04371  Apelin signaling pathway
hsa04540  Gap junction
hsa04611  Platelet activation
hsa04670  Leukocyte transendothelial migration
hsa04713  Circadian entrainment
hsa04723  Retrograde endocannabinoid signaling
hsa04724  Glutamatergic synapse
hsa04725  Cholinergic synapse
hsa04726  Serotonergic synapse
hsa04727  GABAergic synapse
hsa04728  Dopaminergic synapse
hsa04730  Long-term depression
hsa04914  Progesterone-mediated oocyte maturation
hsa04915  Estrogen signaling pathway
hsa04916  Melanogenesis
hsa04921  Oxytocin signaling pathway
hsa04923  Regulation of lipolysis in adipocytes
hsa04924  Renin secretion
hsa04926  Relaxin signaling pathway
hsa04928  Parathyroid hormone synthesis, secretion and action
hsa04934  Cushing syndrome
hsa04971  Gastric acid secretion
hsa05012  Parkinson disease
hsa05030  Cocaine addiction
hsa05032  Morphine addiction
hsa05034  Alcoholism
hsa05133  Pertussis
hsa05142  Chagas disease (American trypanosomiasis)
hsa05145  Toxoplasmosis
hsa05163  Human cytomegalovirus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05200  Pathways in cancer
Network
nt06124  Chemokine signaling (viruses)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06167  Human cytomegalovirus (HCMV)
nt06310  CRH-ACTH-cortisol signaling
nt06360  Cushing syndrome
  Element
N00325  Mutation-inactivated RASD1 to CRHR-PKA-ACTH signaling pathway
N00403  CX3CR1-GNAI-AC-PKA signaling pathway
N00404  HCMV US28 to GNAI-AC-PKA signaling pathway
N00412  HCMV UL33 to GNAI-AC-PKA signaling pathway
N00430  CXCR4-GNAI-PI3K-BAD signaling pathway
N00431  HIV gp120 to CXCR4-GNAI-PI3K-BAD signaling pathway
N00879  PROK-PRKR-Gi-ERK signaling pathway
N00880  Mutation-inactivated PROK2 to PROK-PRKR-Gi-ERK signaling pathway
N00881  Mutation-inactivated PROKR2 to PROK-PRKR-Gi-ERK signaling pathway
Disease
H00033  Adrenal carcinoma
H02269  Familial ventricular tachycardia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    2771 (GNAI2)
   04371 Apelin signaling pathway
    2771 (GNAI2)
   04071 Sphingolipid signaling pathway
    2771 (GNAI2)
   04024 cAMP signaling pathway
    2771 (GNAI2)
   04022 cGMP-PKG signaling pathway
    2771 (GNAI2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    2771 (GNAI2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    2771 (GNAI2)
   04670 Leukocyte transendothelial migration
    2771 (GNAI2)
   04062 Chemokine signaling pathway
    2771 (GNAI2)
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    2771 (GNAI2)
   04915 Estrogen signaling pathway
    2771 (GNAI2)
   04914 Progesterone-mediated oocyte maturation
    2771 (GNAI2)
   04921 Oxytocin signaling pathway
    2771 (GNAI2)
   04926 Relaxin signaling pathway
    2771 (GNAI2)
   04928 Parathyroid hormone synthesis, secretion and action
    2771 (GNAI2)
   04916 Melanogenesis
    2771 (GNAI2)
   04924 Renin secretion
    2771 (GNAI2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    2771 (GNAI2)
  09154 Digestive system
   04971 Gastric acid secretion
    2771 (GNAI2)
  09156 Nervous system
   04724 Glutamatergic synapse
    2771 (GNAI2)
   04727 GABAergic synapse
    2771 (GNAI2)
   04725 Cholinergic synapse
    2771 (GNAI2)
   04728 Dopaminergic synapse
    2771 (GNAI2)
   04726 Serotonergic synapse
    2771 (GNAI2)
   04730 Long-term depression
    2771 (GNAI2)
   04723 Retrograde endocannabinoid signaling
    2771 (GNAI2)
  09158 Development and regeneration
   04360 Axon guidance
    2771 (GNAI2)
  09159 Environmental adaptation
   04713 Circadian entrainment
    2771 (GNAI2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    2771 (GNAI2)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    2771 (GNAI2)
  09165 Substance dependence
   05030 Cocaine addiction
    2771 (GNAI2)
   05032 Morphine addiction
    2771 (GNAI2)
   05034 Alcoholism
    2771 (GNAI2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    2771 (GNAI2)
  09171 Infectious disease: bacterial
   05133 Pertussis
    2771 (GNAI2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    2771 (GNAI2)
   05163 Human cytomegalovirus infection
    2771 (GNAI2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    2771 (GNAI2)
   05142 Chagas disease (American trypanosomiasis)
    2771 (GNAI2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    2771 (GNAI2)
   04031 GTP-binding proteins [BR:hsa04031]
    2771 (GNAI2)
Exosome [BR:hsa04147]
 Exosomal proteins
  Proteins found in most exosomes
   2771 (GNAI2)
GTP-binding proteins [BR:hsa04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 1 (Gi/o) [OT]
    2771 (GNAI2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G-alpha Arf Gtr1_RagA Roc AAA_16 TniB AAA_29
Motif
Other DBs
NCBI-GeneID: 2771
NCBI-ProteinID: NP_002061
OMIM: 139360
HGNC: 4385
Ensembl: ENSG00000114353
Vega: OTTHUMG00000156940
Pharos: P04899(Tbio)
UniProt: P04899 B3KP24
Structure
PDB: 

Position
3p21.31
AA seq 355 aa AA seqDB search
MGCTVSAEDKAAAERSKMIDKNLREDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEDG
YSEEECRQYRAVVYSNTIQSIMAIVKAMGNLQIDFADPSRADDARQLFALSCTAEEQGVL
PDDLSGVIRRLWADHGVQACFGRSREYQLNDSAAYYLNDLERIAQSDYIPTQQDVLRTRV
KTTGIVETHFTFKDLHFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSAYDLVLAEDEE
MNRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKITHSPLTICFPEYTGANKYDEA
ASYIQSKFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKDCGLF
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgggctgcaccgtgagcgccgaggacaaggcggcggccgagcgctctaagatgatcgac
aagaacctgcgggaggacggagagaaggcggcgcgggaggtgaagttgctgctgttgggt
gctggggagtcagggaagagcaccatcgtcaagcagatgaagatcatccacgaggatggc
tactccgaggaggaatgccggcagtaccgggcggttgtctacagcaacaccatccagtcc
atcatggccattgtcaaagccatgggcaacctgcagatcgactttgccgacccctccaga
gcggacgacgccaggcagctatttgcactgtcctgcaccgccgaggagcaaggcgtgctc
cctgatgacctgtccggcgtcatccggaggctctgggctgaccatggtgtgcaggcctgc
tttggccgctcaagggaataccagctcaacgactcagctgcctactacctgaacgacctg
gagcgtattgcacagagtgactacatccccacacagcaagatgtgctacggacccgcgta
aagaccacggggatcgtggagacacacttcaccttcaaggacctacacttcaagatgttt
gatgtgggtggtcagcggtctgagcggaagaagtggatccactgctttgagggcgtcaca
gccatcatcttctgcgtagccttgagcgcctatgacttggtgctagctgaggacgaggag
atgaaccgcatgcatgagagcatgaagctattcgatagcatctgcaacaacaagtggttc
acagacacgtccatcatcctcttcctcaacaagaaggacctgtttgaggagaagatcaca
cacagtcccctgaccatctgcttccctgagtacacaggggccaacaaatatgatgaggca
gccagctacatccagagtaagtttgaggacctgaataagcgcaaagacaccaaggagatc
tacacgcacttcacgtgcgccaccgacaccaagaacgtgcagttcgtgtttgacgccgtc
accgatgtcatcatcaagaacaacctgaaggactgcggcctcttctga

KEGG   Homo sapiens (human): 2773Help
Entry
2773              CDS       T01001                                 

Gene name
GNAI3, 87U6, ARCND1
Definition
(RefSeq) G protein subunit alpha i3
  KO
K04630  guanine nucleotide-binding protein G(i) subunit alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa04015  Rap1 signaling pathway
hsa04022  cGMP-PKG signaling pathway
hsa04024  cAMP signaling pathway
hsa04062  Chemokine signaling pathway
hsa04071  Sphingolipid signaling pathway
hsa04261  Adrenergic signaling in cardiomyocytes
hsa04360  Axon guidance
hsa04371  Apelin signaling pathway
hsa04540  Gap junction
hsa04611  Platelet activation
hsa04670  Leukocyte transendothelial migration
hsa04713  Circadian entrainment
hsa04723  Retrograde endocannabinoid signaling
hsa04724  Glutamatergic synapse
hsa04725  Cholinergic synapse
hsa04726  Serotonergic synapse
hsa04727  GABAergic synapse
hsa04728  Dopaminergic synapse
hsa04730  Long-term depression
hsa04914  Progesterone-mediated oocyte maturation
hsa04915  Estrogen signaling pathway
hsa04916  Melanogenesis
hsa04921  Oxytocin signaling pathway
hsa04923  Regulation of lipolysis in adipocytes
hsa04924  Renin secretion
hsa04926  Relaxin signaling pathway
hsa04928  Parathyroid hormone synthesis, secretion and action
hsa04934  Cushing syndrome
hsa04971  Gastric acid secretion
hsa05012  Parkinson disease
hsa05030  Cocaine addiction
hsa05032  Morphine addiction
hsa05034  Alcoholism
hsa05133  Pertussis
hsa05142  Chagas disease (American trypanosomiasis)
hsa05145  Toxoplasmosis
hsa05163  Human cytomegalovirus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05200  Pathways in cancer
Network
nt06124  Chemokine signaling (viruses)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06167  Human cytomegalovirus (HCMV)
nt06310  CRH-ACTH-cortisol signaling
nt06360  Cushing syndrome
  Element
N00325  Mutation-inactivated RASD1 to CRHR-PKA-ACTH signaling pathway
N00403  CX3CR1-GNAI-AC-PKA signaling pathway
N00404  HCMV US28 to GNAI-AC-PKA signaling pathway
N00412  HCMV UL33 to GNAI-AC-PKA signaling pathway
N00430  CXCR4-GNAI-PI3K-BAD signaling pathway
N00431  HIV gp120 to CXCR4-GNAI-PI3K-BAD signaling pathway
N00879  PROK-PRKR-Gi-ERK signaling pathway
N00880  Mutation-inactivated PROK2 to PROK-PRKR-Gi-ERK signaling pathway
N00881  Mutation-inactivated PROKR2 to PROK-PRKR-Gi-ERK signaling pathway
Disease
H01884  Auriculocondylar syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    2773 (GNAI3)
   04371 Apelin signaling pathway
    2773 (GNAI3)
   04071 Sphingolipid signaling pathway
    2773 (GNAI3)
   04024 cAMP signaling pathway
    2773 (GNAI3)
   04022 cGMP-PKG signaling pathway
    2773 (GNAI3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    2773 (GNAI3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    2773 (GNAI3)
   04670 Leukocyte transendothelial migration
    2773 (GNAI3)
   04062 Chemokine signaling pathway
    2773 (GNAI3)
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    2773 (GNAI3)
   04915 Estrogen signaling pathway
    2773 (GNAI3)
   04914 Progesterone-mediated oocyte maturation
    2773 (GNAI3)
   04921 Oxytocin signaling pathway
    2773 (GNAI3)
   04926 Relaxin signaling pathway
    2773 (GNAI3)
   04928 Parathyroid hormone synthesis, secretion and action
    2773 (GNAI3)
   04916 Melanogenesis
    2773 (GNAI3)
   04924 Renin secretion
    2773 (GNAI3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    2773 (GNAI3)
  09154 Digestive system
   04971 Gastric acid secretion
    2773 (GNAI3)
  09156 Nervous system
   04724 Glutamatergic synapse
    2773 (GNAI3)
   04727 GABAergic synapse
    2773 (GNAI3)
   04725 Cholinergic synapse
    2773 (GNAI3)
   04728 Dopaminergic synapse
    2773 (GNAI3)
   04726 Serotonergic synapse
    2773 (GNAI3)
   04730 Long-term depression
    2773 (GNAI3)
   04723 Retrograde endocannabinoid signaling
    2773 (GNAI3)
  09158 Development and regeneration
   04360 Axon guidance
    2773 (GNAI3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    2773 (GNAI3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    2773 (GNAI3)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    2773 (GNAI3)
  09165 Substance dependence
   05030 Cocaine addiction
    2773 (GNAI3)
   05032 Morphine addiction
    2773 (GNAI3)
   05034 Alcoholism
    2773 (GNAI3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    2773 (GNAI3)
  09171 Infectious disease: bacterial
   05133 Pertussis
    2773 (GNAI3)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    2773 (GNAI3)
   05163 Human cytomegalovirus infection
    2773 (GNAI3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    2773 (GNAI3)
   05142 Chagas disease (American trypanosomiasis)
    2773 (GNAI3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    2773 (GNAI3)
   04031 GTP-binding proteins [BR:hsa04031]
    2773 (GNAI3)
Exosome [BR:hsa04147]
 Exosomal proteins
  Proteins found in most exosomes
   2773 (GNAI3)
GTP-binding proteins [BR:hsa04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 1 (Gi/o) [OT]
    2773 (GNAI3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G-alpha Arf Gtr1_RagA Roc TniB AAA_29 FtsK_SpoIIIE
Motif
Other DBs
NCBI-GeneID: 2773
NCBI-ProteinID: NP_006487
OMIM: 139370
HGNC: 4387
Ensembl: ENSG00000065135
Vega: OTTHUMG00000189112
Pharos: P08754(Tbio)
UniProt: P08754
Structure
PDB: 

Position
1p13.3
AA seq 354 aa AA seqDB search
MGCTLSAEDKAAVERSKMIDRNLREDGEKAAKEVKLLLLGAGESGKSTIVKQMKIIHEDG
YSEDECKQYKVVVYSNTIQSIIAIIRAMGRLKIDFGEAARADDARQLFVLAGSAEEGVMT
PELAGVIKRLWRDGGVQACFSRSREYQLNDSASYYLNDLDRISQSNYIPTQQDVLRTRVK
TTGIVETHFTFKDLYFKMFDVGGQRSERKKWIHCFEGVTAIIFCVALSDYDLVLAEDEEM
NRMHESMKLFDSICNNKWFTETSIILFLNKKDLFEEKIKRSPLTICYPEYTGSNTYEEAA
AYIQCQFEDLNRRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLKECGLY
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgggctgcacgttgagcgccgaagacaaggcggcagtggagcgaagcaagatgatcgac
cgcaacttacgggaggacggggaaaaagcggccaaagaagtgaagctgctgctactcggt
gctggagaatctggtaaaagcaccattgtgaaacagatgaaaatcattcatgaggatggc
tattcagaggatgaatgtaaacaatataaagtagttgtctacagcaatactatacagtcc
atcattgcaatcataagagccatgggacggctaaagattgactttggggaagctgccagg
gcagatgatgcccggcaattatttgttttagctggcagtgctgaagaaggagtcatgact
ccagaactagcaggagtgattaaacggttatggcgagatggtggggtacaagcttgcttc
agcagatccagggaatatcagctcaatgattctgcttcatattatctaaatgatctggat
agaatatcccagtctaactacattccaactcagcaagatgttcttcggacgagagtgaag
accacaggcattgtagaaacacatttcaccttcaaagacctatacttcaagatgtttgat
gtaggtggccaaagatcagaacgaaaaaagtggattcactgttttgagggagtgacagca
attatcttctgtgtggccctcagtgattatgaccttgttctggctgaggacgaggagatg
aaccgaatgcatgaaagcatgaaactgtttgacagcatttgtaataacaaatggtttaca
gaaacttcaatcattctcttccttaacaagaaagacctttttgaggaaaaaataaagagg
agtccgttaactatctgttatccagaatacacaggttccaatacatatgaagaggcagct
gcctatattcaatgccagtttgaagatctgaacagaagaaaagataccaaggagatctat
actcacttcacctgtgccacagacacgaagaatgtgcagtttgtttttgatgctgttaca
gatgtcatcattaaaaacaacttaaaggaatgtggactttattga

DBGET integrated database retrieval system