KEGG   Homo sapiens (human): 2774Help
Entry
2774              CDS       T01001                                 

Gene name
GNAL, DYT25
Definition
(RefSeq) G protein subunit alpha L
  KO
K04633  guanine nucleotide-binding protein G(olf) subunit alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa04020  Calcium signaling pathway
hsa04728  Dopaminergic synapse
hsa04740  Olfactory transduction
hsa05012  Parkinson disease
hsa05142  Chagas disease (American trypanosomiasis)
hsa05146  Amoebiasis
Disease
H00831  Primary dystonia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    2774 (GNAL)
 09150 Organismal Systems
  09156 Nervous system
   04728 Dopaminergic synapse
    2774 (GNAL)
  09157 Sensory system
   04740 Olfactory transduction
    2774 (GNAL)
 09160 Human Diseases
  09164 Neurodegenerative diseases
   05012 Parkinson disease
    2774 (GNAL)
  09174 Infectious diseases: Parasitic
   05146 Amoebiasis
    2774 (GNAL)
   05142 Chagas disease (American trypanosomiasis)
    2774 (GNAL)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:hsa04031]
    2774 (GNAL)
GTP-binding proteins [BR:hsa04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 2 (Gs)
    2774 (GNAL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G-alpha Arf Gtr1_RagA Roc GTP_EFTU TniB AAA_29
Motif
Other DBs
NCBI-GeneID: 2774
NCBI-ProteinID: NP_001135811
OMIM: 139312
HGNC: 4388
Ensembl: ENSG00000141404
Vega: OTTHUMG00000131660
Pharos: P38405(Tbio)
UniProt: P38405 A8K1Y9
Position
18p11.21
AA seq 381 aa AA seqDB search
MGCLGGNSKTTEDQGVDEKERREANKKIEKQLQKERLAYKATHRLLLLGAGESGKSTIVK
QMRILHVNGFNPEEKKQKILDIRKNVKDAIVTIVSAMSTIIPPVPLANPENQFRSDYIKS
IAPITDFEYSQEFFDHVKKLWDDEGVKACFERSNEYQLIDCAQYFLERIDSVSLVDYTPT
DQDLLRCRVLTSGIFETRFQVDKVNFHMFDVGGQRDERRKWIQCFNDVTAIIYVAACSSY
NMVIREDNNTNRLRESLDLFESIWNNRWLRTISIILFLNKQDMLAEKVLAGKSKIEDYFP
EYANYTVPEDATPDAGEDPKVTRAKFFIRDLFLRISTATGDGKHYCYPHFTCAVDTENIR
RVFNDCRDIIQRMHLKQYELL
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atggggtgtttgggcggcaacagcaagacgacggaagaccagggcgtcgatgaaaaagaa
cgacgcgaggccaacaaaaagatcgagaagcagttgcagaaagagcgcctggcttacaag
gctacccaccgcctgctgctcctgggggctggtgagtctgggaaaagcactatcgtcaaa
cagatgaggatcctgcacgtcaatgggtttaatcccgaggaaaagaaacagaaaattctg
gacatccggaaaaatgttaaagatgctatcgtgacaattgtttcagcaatgagtactata
atacctccagttccgctggccaaccctgaaaaccaatttcgatcagactacatcaagagc
atagcccctatcactgactttgaatattcccaggaattctttgaccatgtgaaaaaactt
tgggacgatgaaggcgtgaaggcatgctttgagagatccaacgaataccagctgattgac
tgtgcacaatacttcctggaaagaatcgacagcgtcagcttggttgactacacacccaca
gaccaggacctcctcagatgcagagttctgacatctgggatttttgagacacgattccaa
gtggacaaagtaaacttccacatgtttgatgttggtggccagagggatgagaggagaaaa
tggatccagtgctttaacgatgtcacagctatcatttacgtcgcagcctgcagtagctac
aacatggtgattcgagaagataacaacaccaacaggctgagagagtccctggatcttttt
gaaagcatctggaacaacaggtggttacggaccatttctatcatcttgttcttgaacaaa
caagatatgctggcagaaaaagtcttggcagggaaatcaaaaattgaagactatttccca
gaatatgcaaattatactgttcctgaagacgcaacaccagatgcaggagaagatcccaaa
gttacaagagccaagttctttatccgggacctgtttttgaggatcagcacggccaccggt
gacggcaaacattactgctacccgcacttcacctgcgccgtggacacagagaacatccgc
agggtgttcaacgactgccgcgacatcatccagcggatgcacctcaagcagtatgagctc
ttgtga

DBGET integrated database retrieval system