KEGG   Homo sapiens (human): 2785Help
Entry
2785              CDS       T01001                                 

Gene name
GNG3
Definition
(RefSeq) G protein subunit gamma 3
  KO
K04540  guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04014  Ras signaling pathway
hsa04062  Chemokine signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04371  Apelin signaling pathway
hsa04713  Circadian entrainment
hsa04723  Retrograde endocannabinoid signaling
hsa04724  Glutamatergic synapse
hsa04725  Cholinergic synapse
hsa04726  Serotonergic synapse
hsa04727  GABAergic synapse
hsa04728  Dopaminergic synapse
hsa04926  Relaxin signaling pathway
hsa05032  Morphine addiction
hsa05034  Alcoholism
hsa05163  Human cytomegalovirus infection
hsa05167  Kaposi's sarcoma-associated herpesvirus infection
hsa05200  Pathways in cancer
Network
N00152  CXCR-GNB/G-ERK signaling pathway
N00153  CXCR-GNB/G-PI3K-JNK signaling pathway
N00154  CXCR-GNB/G-PI3K-AKT signaling pathway
N00157  KSHV vGPCR to GNB/G-ERK signaling pathway
N00158  KSHV vGPCR to GNB/G-PI3K-AKT signaling pathway
N00178  KSHV vGPCR to GNB/G-PI3K-JNK signaling pathway
N00206  KSHV vGPCR to host-cell-protein activation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    2785 (GNG3)
   04371 Apelin signaling pathway
    2785 (GNG3)
   04151 PI3K-Akt signaling pathway
    2785 (GNG3)
 Organismal Systems
  Immune system
   04062 Chemokine signaling pathway
    2785 (GNG3)
  Endocrine system
   04926 Relaxin signaling pathway
    2785 (GNG3)
  Nervous system
   04724 Glutamatergic synapse
    2785 (GNG3)
   04727 GABAergic synapse
    2785 (GNG3)
   04725 Cholinergic synapse
    2785 (GNG3)
   04728 Dopaminergic synapse
    2785 (GNG3)
   04726 Serotonergic synapse
    2785 (GNG3)
   04723 Retrograde endocannabinoid signaling
    2785 (GNG3)
  Environmental adaptation
   04713 Circadian entrainment
    2785 (GNG3)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    2785 (GNG3)
  Substance dependence
   05032 Morphine addiction
    2785 (GNG3)
   05034 Alcoholism
    2785 (GNG3)
  Infectious diseases
   05163 Human cytomegalovirus infection
    2785 (GNG3)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    2785 (GNG3)
GTP-binding proteins [BR:hsa04031]
 Heterotrimeric G-proteins
  Gamma Subunits
   Gamma [OT]
    2785 (GNG3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G-gamma
Motif
Other DBs
NCBI-GeneID: 2785
NCBI-ProteinID: NP_036334
OMIM: 608941
HGNC: 4405
Ensembl: ENSG00000162188
Vega: OTTHUMG00000167560
Pharos: P63215(Tdark)
UniProt: P63215
Position
11q12.3
AA seq 75 aa AA seqDB search
MKGETPVNSTMSIGQARKMVEQLKIEASLCRIKVSKAAADLMTYCDAHACEDPLITPVPT
SENPFREKKFFCALL
NT seq 228 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggtgagaccccggtgaacagcactatgagtattgggcaagcacgcaagatggtg
gaacagcttaagattgaagccagcttgtgtcggataaaggtgtccaaggcagcagcagac
ctgatgacttactgtgatgcccacgcctgtgaggatcccctcatcacccctgtgcccact
tcggagaaccccttccgggagaagaagttcttctgtgctctcctctga

DBGET integrated database retrieval system