Entry |
|
Symbol |
GNG5
|
Name |
(RefSeq) G protein subunit gamma 5
|
KO |
K04542 | guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-5 |
|
Organism |
|
Pathway |
hsa04723 | Retrograde endocannabinoid signaling |
hsa05163 | Human cytomegalovirus infection |
hsa05167 | Kaposi sarcoma-associated herpesvirus infection |
hsa05170 | Human immunodeficiency virus 1 infection |
|
Network |
nt06124 Chemokine signaling (viruses) nt06150 Cytokine-cytokine receptor interaction (viruses) nt06161 Human immunodeficiency virus type 1 (HIV-1) nt06164 Kaposi sarcoma-associated herpesvirus (KSHV) nt06167 Human cytomegalovirus (HCMV) nt06224 CXCR signaling |
Element |
N00152 | CXCR-GNB/G-ERK signaling pathway |
N00153 | CCR/CXCR-GNB/G-PI3K-RAC signaling pathway |
N00154 | CXCR-GNB/G-PI3K-AKT signaling pathway |
N00157 | KSHV vGPCR to GNB/G-ERK signaling pathway |
N00158 | KSHV vGPCR to GNB/G-PI3K-AKT signaling pathway |
N00178 | KSHV vGPCR to GNB/G-PI3K-JNK signaling pathway |
N00399 | CCR2-GNB/G-PI3K-NFKB signaling pathway |
N00400 | HCMV US28 to GNB/G-PI3K-NFKB signaling pathway |
N00408 | LPAR-GNB/G-Rho signaling pathway |
N00409 | HCMV UL33 to GNB/G-Rho signaling pathway |
N00413 | CXCR4-GNB/G-PLCB-PKC signaling pathway |
N00428 | CCR5-GNB/G-PLCB/G-PKC signaling pathway |
N00433 | CXCR4-GNB/G-RAC signaling pathway |
N00434 | HIV gp120 to CXCR4-GNB/G-RAC signaling pathway |
|
Brite |
KEGG Orthology (KO) [BR:hsa00001]
09130 Environmental Information Processing
09132 Signal transduction
04014 Ras signaling pathway
2787 (GNG5)
04371 Apelin signaling pathway
2787 (GNG5)
04151 PI3K-Akt signaling pathway
2787 (GNG5)
09150 Organismal Systems
09151 Immune system
04062 Chemokine signaling pathway
2787 (GNG5)
09152 Endocrine system
04926 Relaxin signaling pathway
2787 (GNG5)
09156 Nervous system
04724 Glutamatergic synapse
2787 (GNG5)
04727 GABAergic synapse
2787 (GNG5)
04725 Cholinergic synapse
2787 (GNG5)
04728 Dopaminergic synapse
2787 (GNG5)
04726 Serotonergic synapse
2787 (GNG5)
04723 Retrograde endocannabinoid signaling
2787 (GNG5)
09159 Environmental adaptation
04713 Circadian entrainment
2787 (GNG5)
09160 Human Diseases
09161 Cancer: overview
05200 Pathways in cancer
2787 (GNG5)
09172 Infectious disease: viral
05170 Human immunodeficiency virus 1 infection
2787 (GNG5)
05163 Human cytomegalovirus infection
2787 (GNG5)
05167 Kaposi sarcoma-associated herpesvirus infection
2787 (GNG5)
09165 Substance dependence
05032 Morphine addiction
2787 (GNG5)
05034 Alcoholism
2787 (GNG5)
09180 Brite Hierarchies
09183 Protein families: signaling and cellular processes
04147 Exosome [BR:hsa04147]
2787 (GNG5)
04031 GTP-binding proteins [BR:hsa04031]
2787 (GNG5)
Exosome [BR:hsa04147]
Exosomal proteins
Exosomal proteins of haemopoietic cells (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
2787 (GNG5)
GTP-binding proteins [BR:hsa04031]
Heterotrimeric G-proteins
Gamma Subunits
Gamma [OT]
2787 (GNG5)
|
SSDB |
|
Motif |
|
Other DBs |
|
Position |
1:complement(84498325..84506581)
|
AA seq |
68 aa
MSGSSSVAAMKKVVQQLRLEAGLNRVKVSQAAADLKQFCLQNAQHDPLLTGVSSSTNPFR
PQKVCSFL |
NT seq |
207 nt +upstreamnt +downstreamnt
atgtctggctcctccagcgtcgccgctatgaagaaagtggttcaacagctccggctggag
gccggactcaaccgcgtaaaagtttcccaggcagctgcagacttgaaacagttctgtctg
cagaatgctcaacatgaccctctgctgactggagtatcttcaagtacaaatcccttcaga
ccccagaaagtctgttcctttttgtag |