KEGG   Homo sapiens (human): 2796Help
Entry
2796              CDS       T01001                                 

Gene name
GNRH1, GNRH, GRH, LHRH, LNRH
Definition
(RefSeq) gonadotropin releasing hormone 1
  KO
K05252  gonadotropin-releasing hormone
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04912  GnRH signaling pathway
hsa04929  GnRH secretion
Network
nt06323  KISS1-GnRH-LH/FSH-E2 signaling
  Element
N00873  GnRH-GnRHR-PLCB-PKC signaling pathway
N00874  Mutation-inactivated GnRH to GnRH-GnRHR-PLCB-PKC signaling pathway
N00875  Mutation-inactivated GnRHR to GnRH-GnRHR-PLCB-PKC signaling pathway
Disease
H00255  Hypogonadotropic hypogonadism
Drug target
Detirelix acetate: D03701
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    2796 (GNRH1)
 09150 Organismal Systems
  09152 Endocrine system
   04929 GnRH secretion
    2796 (GNRH1)
   04912 GnRH signaling pathway
    2796 (GNRH1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GnRH
Motif
Other DBs
NCBI-GeneID: 2796
NCBI-ProteinID: NP_001076580
OMIM: 152760
HGNC: 4419
Ensembl: ENSG00000147437
Vega: OTTHUMG00000163852
Pharos: P01148(Tbio)
CPD: C07607
UniProt: P01148
Position
8p21.2
AA seq 92 aa AA seqDB search
MKPIQKLLAGLILLTWCVEGCSSQHWSYGLRPGGKRDAENLIDSFQEIVKEVGQLAETQR
FECTTHQPRSPLRDLKGALESLIEEETGQKKI
NT seq 279 nt NT seq  +upstreamnt  +downstreamnt
atgaagccaattcaaaaactcctagctggccttattctactgacttggtgcgtggaaggc
tgctccagccagcactggtcctatggactgcgccctggaggaaagagagatgccgaaaat
ttgattgattctttccaagagatagtcaaagaggttggtcaactggcagaaacccaacgc
ttcgaatgcaccacgcaccagccacgttctcccctccgagacctgaaaggagctctggaa
agtctgattgaagaggaaactgggcagaagaagatttaa

DBGET integrated database retrieval system