KEGG   Homo sapiens (human): 2798Help
Entry
2798              CDS       T01001                                 

Gene name
GNRHR, GNRHR1, GRHR, HH7, LHRHR, LRHR
Definition
(RefSeq) gonadotropin releasing hormone receptor
  KO
K04280  gonadotropin-releasing hormone receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04912  GnRH signaling pathway
Network
nt06323  KISS1-GnRH-LH-estrogen signaling
  Element
N00873  GnRH-GnRHR-PLCB-PKC signaling pathway
N00874  Mutation-inactivated GnRH to GnRH-GnRHR-PLCB-PKC signaling pathway
N00875  Mutation-inactivated GnRHR to GnRH-GnRHR-PLCB-PKC signaling pathway
Disease
H00255  Hypogonadotropic hypogonadism
Drug target
Abarelix: D02738
Buserelin (DG00729): D01831 D07259
Cetrorelix (DG00505): D01685 D07665
Degarelix (DG00736): D08635 D08901 D09400
Elagolix (DG01345): D09335 D09336
Fertirelin (DG01346): D07957
Ganirelix (DG00504): D04302 D08010
Gonadorelin (DG00499): D00988 D03267 D04361 D08027
Goserelin (DG00731): D00573 D04405
Histrelin (DG00733): D02116 D02369
Iturelix: D04644
Leuprorelin (DG00730): D00989 D08113
Linzagolix (DG03061): D11608 D11609
Lutrelin acetate: D04823
Nafarelin (DG00500): D00990 D08241
Opigolix: D11351
Prazarelix acetate: D05599
Relugolix: D10888
Triptorelin (DG00732): D06247 D06248 D08649
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    2798 (GNRHR)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    2798 (GNRHR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    2798 (GNRHR)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Peptide
   Gonadotropin-releasing hormone (GnRH)
    2798 (GNRHR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 DUF3307
Motif
Other DBs
NCBI-GeneID: 2798
NCBI-ProteinID: NP_000397
OMIM: 138850
HGNC: 4421
Ensembl: ENSG00000109163
Vega: OTTHUMG00000129302
Pharos: P30968(Tclin)
UniProt: P30968
Position
4q13.2
AA seq 328 aa AA seqDB search
MANSASPEQNQNHCSAINNSIPLMQGNLPTLTLSGKIRVTVTFFLFLLSATFNASFLLKL
QKWTQKKEKGKKLSRMKLLLKHLTLANLLETLIVMPLDGMWNITVQWYAGELLCKVLSYL
KLFSMYAPAFMMVVISLDRSLAITRPLALKSNSKVGQSMVGLAWILSSVFAGPQLYIFRM
IHLADSSGQTKVFSQCVTHCSFSQWWHQAFYNFFTFSCLFIIPLFIMLICNAKIIFTLTR
VLHQDPHELQLNQSKNNIPRARLKTLKMTVAFATSFTVCWTPYYVLGIWYWFDPEMLNRL
SDPVNHFFFLFAFLNPCFDPLIYGYFSL
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atggcaaacagtgcctctcctgaacagaatcaaaatcactgttcagccatcaacaacagc
atcccactgatgcagggcaacctccccactctgaccttgtctggaaagatccgagtgacg
gttactttcttcctttttctgctctctgcgacctttaatgcttctttcttgttgaaactt
cagaagtggacacagaagaaagagaaagggaaaaagctctcaagaatgaagctgctctta
aaacatctgaccttagccaacctgttggagactctgattgtcatgccactggatgggatg
tggaacattacagtccaatggtatgctggagagttactctgcaaagttctcagttatcta
aagcttttctccatgtatgccccagccttcatgatggtggtgatcagcctggaccgctcc
ctggctatcacgaggcccctagctttgaaaagcaacagcaaagtcggacagtccatggtt
ggcctggcctggatcctcagtagtgtctttgcaggaccacagttatacatcttcaggatg
attcatctagcagacagctctggacagacaaaagttttctctcaatgtgtaacacactgc
agtttttcacaatggtggcatcaagcattttataactttttcaccttcagctgcctcttc
atcatccctcttttcatcatgctgatctgcaatgcaaaaatcatcttcaccctgacacgg
gtccttcatcaggacccccacgaactacaactgaatcagtccaagaacaatataccaaga
gcacggctgaagactctaaaaatgacggttgcatttgccacttcatttactgtctgctgg
actccctactatgtcctaggaatttggtattggtttgatcctgaaatgttaaacaggttg
tcagacccagtaaatcacttcttctttctctttgcctttttaaacccatgctttgatcca
cttatctatggatatttttctctgtga

DBGET integrated database retrieval system