KEGG   Homo sapiens (human): 2799
Entry
2799              CDS       T01001                                 

Gene name
GNS, G6S
Definition
(RefSeq) glucosamine (N-acetyl)-6-sulfatase
  KO
K01137  N-acetylglucosamine-6-sulfatase [EC:3.1.6.14]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00531  Glycosaminoglycan degradation
hsa01100  Metabolic pathways
hsa04142  Lysosome
Module
hsa_M00078  Heparan sulfate degradation
hsa_M00079  Keratan sulfate degradation
Network
nt06012  Glycosaminoglycan degradation
  Element
N00615  Heparan sulfate degradation
N00616  GNS deficiency in heparan sulfate degradation
N00623  Keratan sulfate degradation
N00624  GNS deficiency in keratan sulfate degradation
Disease
H00130  Mucopolysaccharidosis type III
H00421  Mucopolysaccharidosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    2799 (GNS)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    2799 (GNS)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.6  Sulfuric-ester hydrolases
    3.1.6.14  N-acetylglucosamine-6-sulfatase
     2799 (GNS)
SSDB
Motif
Pfam: Sulfatase Phosphodiest
Other DBs
NCBI-GeneID: 2799
NCBI-ProteinID: NP_002067
OMIM: 607664
HGNC: 4422
Ensembl: ENSG00000135677
Vega: OTTHUMG00000168819
Pharos: P15586(Tbio)
UniProt: P15586 A0A024RBC5 Q7Z3X3
Position
12q14.3
AA seq 552 aa
MRLLPLAPGRLRRGSPRHLPSCSPALLLLVLGGCLGVFGVAAGTRRPNVVLLLTDDQDEV
LGGMTPLKKTKALIGEMGMTFSSAYVPSALCCPSRASILTGKYPHNHHVVNNTLEGNCSS
KSWQKIQEPNTFPAILRSMCGYQTFFAGKYLNEYGAPDAGGLEHVPLGWSYWYALEKNSK
YYNYTLSINGKARKHGENYSVDYLTDVLANVSLDFLDYKSNFEPFFMMIATPAPHSPWTA
APQYQKAFQNVFAPRNKNFNIHGTNKHWLIRQAKTPMTNSSIQFLDNAFRKRWQTLLSVD
DLVEKLVKRLEFTGELNNTYIFYTSDNGYHTGQFSLPIDKRQLYEFDIKVPLLVRGPGIK
PNQTSKMLVANIDLGPTILDIAGYDLNKTQMDGMSLLPILRGASNLTWRSDVLVEYQGEG
RNVTDPTCPSLSPGVSQCFPDCVCEDAYNNTYACVRTMSALWNLQYCEFDDQEVFVEVYN
LTADPDQITNIAKTIDPELLGKMNYRLMMLQSCSGPTCRTPGVFDPGYRFDPRLMFSNRG
SVRTRRFSKHLL
NT seq 1659 nt   +upstreamnt  +downstreamnt
atgcggctcctgcctctagccccaggtcggctccggcggggcagcccccgccacctgccc
tcctgcagcccagcgctgctactgctggtgctgggcggctgcctgggggtcttcggggtg
gctgcgggaacccggaggcccaacgtggtgctgctcctcacggacgaccaggacgaagtg
ctcggcggcatgacaccgctaaagaaaaccaaagctctcatcggagagatggggatgact
ttttccagtgcttatgtgccaagtgctctctgctgccccagcagagccagtatcctgaca
ggaaagtacccacataatcatcacgttgtgaacaacactctggaggggaactgcagtagt
aagtcctggcagaagatccaagaaccaaatactttcccagcaattctcagatcaatgtgt
ggttatcagaccttttttgcagggaaatatttaaatgagtacggagccccagatgcaggt
ggactagaacacgttcctctgggttggagttactggtatgccttggaaaagaattctaag
tattataattacaccctgtctatcaatgggaaggcacggaagcatggtgaaaactatagt
gtggactacctgacagatgttttggctaatgtctccttggactttctggactacaagtcc
aactttgagcccttcttcatgatgatcgccactccagcgcctcattcgccttggacagct
gcacctcagtaccagaaggctttccagaatgtctttgcaccaagaaacaagaacttcaac
atccatggaacgaacaagcactggttaattaggcaagccaagactccaatgactaattct
tcaatacagtttttagataatgcatttaggaaaaggtggcaaactctcctctcagttgat
gaccttgtggagaaactggtcaagaggctggagttcactggggagctcaacaacacttac
atcttctatacctcagacaatggctatcacacaggacagttttccttgccaatagacaag
agacagctgtatgagtttgatatcaaagttccactgttggttcgaggacctgggatcaaa
ccaaatcagacaagcaagatgctggttgccaacattgacttgggtcctactattttggac
attgctggctacgacctaaataagacacagatggatgggatgtccttattgcccattttg
agaggtgccagtaacttgacctggcgatcagatgtcctggtggaataccaaggagaaggc
cgtaacgtcactgacccaacatgcccttccctgagtcctggcgtatctcaatgcttccca
gactgtgtatgtgaagatgcttataacaatacctatgcctgtgtgaggacaatgtcagca
ttgtggaatttgcagtattgcgagtttgatgaccaggaggtgtttgtagaagtctataat
ctgactgcagacccagaccagatcactaacattgctaaaaccatagacccagagctttta
ggaaagatgaactatcggttaatgatgttacagtcctgttctgggccaacctgtcgcact
ccaggggtttttgaccccggatacaggtttgacccccgtctcatgttcagcaatcgcggc
agtgtcaggactcgaagattttccaaacatcttctgtag

DBGET integrated database retrieval system