KEGG   Homo sapiens (human): 2800
Entry
2800              CDS       T01001                                 

Gene name
GOLGA1, golgin-97
Definition
(RefSeq) golgin A1
  KO
K16731  golgin subfamily A member 1
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    2800 (GOLGA1)
   03036 Chromosome and associated proteins [BR:hsa03036]
    2800 (GOLGA1)
Membrane trafficking [BR:hsa04131]
 Endosome - Golgi transport
  Rab GTPases and associated proteins
   Rab associated proteins
    2800 (GOLGA1)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     2800 (GOLGA1)
SSDB
Motif
Pfam: GRIP CENP-F_leu_zip
Other DBs
NCBI-GeneID: 2800
NCBI-ProteinID: NP_002068
OMIM: 602502
HGNC: 4424
Ensembl: ENSG00000136935
Vega: OTTHUMG00000020665
Pharos: Q92805(Tbio)
UniProt: Q92805 A0A024R869
Position
9q33.3
AA seq 767 aa
MFAKLKKKIAEETAVAQRPGGATRIPRSVSKESVASMGADSGDDFASDGSSSREDLSSQL
LRRNEQIRKLEARLSDYAEQVRNLQKIKEKLEIALEKHQDSSMRKFQEQNETFQANRAKM
AEGLALALARKDQEWSEKMDQLEKEKNILTAQLQEMKNQSMNLFQRRDEMDELEGFQQQE
LSKIKHMLLKKEESLGKMEQELEARTRELSRTQEELMNSNQMSSDLSQKLEELQRHYSTL
EEQRDHVIASKTGAESKITALEQKEQELQALIQQLSIDLQKVTAETQEKEDVITHLQEKV
ASLEKRLEQNLSGEEHLQELLKEKTLAEQNLEDTRQQLLAARSSQAKAINTLETRVRELE
QTLQASEEQLQQSKGIVAAQETQIQELAAANQESSHVQQQALALEQQFLERTQALEAQIV
ALERTRAADQTTAEQGMRQLEQENAALKECRNEYERSLQNHQFELKKLKEEWSQREIVSV
AMAQALEEVRKQREEFQQQAANLTAIIDEKEQNLREKTEVLLQKEQEILQLERGHNSALL
QIHQLQAELEALRTLKAEEAAVVAEQEDLLRLRGPLQAEALSVNESHVTSRAMQDPVFQL
PTAGRTPNGEVGAMDLTQLQKEKQDLEQQLLEKNKTIKQMQQRMLELRKTLQKELKIRPD
NELFEVREKPGPEMANMAPSVTNNTDLTDAREINFEYLKHVVLKFMSCRESEAFHLIKAV
SVLLNFSQEEENMLKETLEYKMSWFGSKPAPKGSIRPSISNPRIPWS
NT seq 2304 nt   +upstreamnt  +downstreamnt
atgtttgcaaaactgaagaagaaaattgcagaagagactgctgttgctcagaggccagga
ggtgctactaggatcccacggtctgtgagcaaggaatcagttgcctcaatgggagctgac
tcaggagatgactttgcttccgatggaagcagctccagagaagatctttcatcccagctt
ctgagaaggaatgaacagatacggaagttagaggccagactttctgactatgctgaacag
gtccgaaacttgcagaagataaaagagaagcttgaaattgcattagaaaaacaccaggat
tcttccatgcggaaatttcaagagcagaatgagacattccaagccaacagagccaaaatg
gcagaaggactggctttggcattagccagaaaggaccaggaatggtcagaaaagatggat
cagcttgaaaaggagaaaaatattctgacagcccagttacaggaaatgaagaaccagagt
atgaatcttttccaaaggagagatgaaatggatgaattagaggggttccagcagcaggaa
ctaagtaaaataaagcacatgcttttaaaaaaagaagaaagtctagggaaaatggaacaa
gaattggaggcacgaaccagagaacttagtcgtacccaggaggagttgatgaactccaat
cagatgtcatcagacttaagccagaagctagaagaattgcagagacactactcaacgctg
gaagagcagagagatcatgtgatagcttcaaaaacaggtgcagaaagtaagatcacagcc
ctggaacaaaaggaacaagagctccaagcactcattcagcagctttccattgatttgcaa
aaggtcactgctgaaactcaagagaaagaagacgttatcacacatttgcaagagaaggtt
gcatccttggagaagagactagaacagaacttatcaggagaagaacacttgcaagaactc
ctgaaagagaaaacacttgctgagcagaatttggaggataccagacaacagctcttggca
gccagaagcagccaggctaaggccattaacaccctggagactcgggtgagagaactggag
cagaccttgcaggcctctgaggagcagctccaacagagcaagggcattgtggctgcccag
gaaactcagatacaggagctcgctgccgccaaccaggagagcagccatgtgcagcagcag
gcccttgctctggagcagcagttcttggagcgcacccaggcgctagaagcccagatagtg
gccctggagagaacgcgggcagctgaccagaccaccgcagagcaagggatgagacaactg
gagcaagaaaatgcagcccttaaagaatgcaggaatgaatatgaacgttctttacaaaat
caccaatttgaactaaagaagctgaaggaagaatggagccaaagagaaattgtgagcgtg
gccatggctcaagccctggaggaggtgcggaagcaaagggaagagttccagcaacaggca
gctaacctgacagccataatagacgagaaggaacagaatctgcgggaaaaaaccgaagtg
cttctccagaaagagcaggagattctccagctggagcgaggtcacaactctgccctgctg
cagatacaccagctgcaggccgagctggaggccctgaggaccctcaaggcggaggaggct
gcagtggtcgcggagcaggaggacctgctgaggctgcggggcccattgcaggccgaagca
ctctcagtcaatgagtcgcacgtgacctcgagggccatgcaggaccctgtgttccagctt
ccaactgcaggaagaacaccaaatggtgaggttggggccatggatctcacacagctacag
aaggagaaacaggacttggagcagcaacttctggagaaaaataagaccataaagcagatg
cagcagcggatgctggagctccggaagactctgcagaaggagctgaaaatcagacccgat
aatgagctcttcgaagtccgggagaaacctggacctgagatggcaaacatggcgccttcc
gtcacgaataacactgacctgacagatgcccgcgagatcaactttgagtaccttaaacat
gtggttttaaaattcatgtcttgtcgcgaatccgaggcttttcatcttataaaagctgtg
tcagtgttgctgaacttttcccaagaggaggagaacatgctcaaggaaactctggaatat
aagatgtcatggtttgggtccaaaccagctcccaagggcagcatccggccgtctatctca
aaccctcggataccatggtcctag

DBGET integrated database retrieval system