KEGG   Homo sapiens (human): 2801Help
Entry
2801              CDS       T01001                                 

Gene name
GOLGA2, GM130
Definition
(RefSeq) golgin A2
  KO
K20358  golgin subfamily A member 2
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    2801 (GOLGA2)
Membrane trafficking [BR:hsa04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   Rab associated proteins
    2801 (GOLGA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GOLGA2L5 DivIVA
Motif
Other DBs
NCBI-GeneID: 2801
NCBI-ProteinID: NP_004477
OMIM: 602580
HGNC: 4425
Ensembl: ENSG00000167110
Vega: OTTHUMG00000020732
Pharos: Q08379(Tbio)
UniProt: Q08379
Structure
PDB: 

Position
9q34.11
AA seq 990 aa AA seqDB search
MSEETRQSKLAAAKKKLREYQQRNSPGVPTGAKKKKKIKNGSNPETTTSGGCHSPEDTPK
DNAATLQPSDDTVLPGGVPSPGASLTSMAASQNHDADNVPNLMDETKTFSSTESLRQLSQ
QLNGLVCESATCVNGEGPASSANLKDLESRYQQLAVALDSSYVTNKQLNITIEKLKQQNQ
EITDQLEEEKKECHQKQGALREQLQVHIQTIGILVSEKAELQTALAHTQHAARQKEGESE
DLASRLQYSRRRVGELERALSAVSTQQKKADRYNKELTKERDALRLELYKNTQSNEDLKQ
EKSELEEKLRVLVTEKAGMQLNLEELQKKLEMTELLLQQFSSRCEAPDANQQLQQAMEER
AQLEAHLGQVMESVRQLQMERDKYAENLKGESAMWRQRMQQMSEQVHTLREEKECSMSRV
QELETSLAELRNQMAEPPPPEPPAGPSEVEQQLQAEAEHLRKELEGLAGQLQAQVQDNEG
LSRLNREQEERLLELERAAELWGEQAEARRQILETMQNDRTTISRALSQNRELKEQLAEL
QSGFVKLTNENMEITSALQSEQHVKRELGKKLGELQEKLSELKETVELKSQEAQSLQQQR
DQYLGHLQQYVAAYQQLTSEKEVLHNQLLLQTQLVDQLQQQEAQGKAVAEMARQELQETQ
ERLEAATQQNQQLRAQLSLMAHPGEGDGLDREEEEDEEEEEEEAVAVPQPMPSIPEDLES
REAMVAFFNSAVASAEEEQARLRGQLKEQRVRCRRLAHLLASAQKEPEAAAPAPGTGGDS
VCGETHRALQGAMEKLQSRFMELMQEKADLKERVEELEHRCIQLSGETDTIGEYIALYQS
QRAVLKERHREKEEYISRLAQDKEEMKVKLLELQELVLRLVGDRNEWHGRFLAAAQNPAD
EPTSGAPAPQELGAANQQGDLCEVSLAGSVEPAQGEAREGSPRDNPTAQQIMQLLREMQN
PRERPGLGSNPCIPFFYRADENDEVKITVI
NT seq 2973 nt NT seq  +upstreamnt  +downstreamnt
atgtcggaagaaacccgacagagcaaattggccgcagcgaagaaaaagttgagagaatat
cagcagaggaatagccctggtgttcctacaggagcgaaaaagaagaagaaaataaaaaat
ggcagtaaccctgagacaaccacttctggtggttgccactcacctgaggatacacccaag
gacaatgctgctactctacaaccatctgatgacaccgtgttacctggcggtgtcccttcc
cctggtgccagtctcactagcatggcggcatctcagaatcatgatgctgacaatgtccct
aatctcatggatgaaaccaagactttctcatcaaccgagagcctgcgacaactctcccaa
cagctcaatggtcttgtttgtgagtctgcgacatgtgtcaatggggagggccctgcatcg
tctgctaacctgaaggatctggagagccggtaccaacagctagcggtagccctggactcc
agctatgtaacaaacaaacaactcaatatcacgatagagaaattgaaacaacagaaccaa
gaaattacggatcagttggaagaagaaaagaaagaatgccaccaaaagcagggagcccta
agggagcagttacaggttcacattcagaccatagggatcctcgtatcagagaaagctgag
ttacagacagccctggctcacactcagcatgctgccaggcagaaagaaggagagtctgaa
gatctggccagccgcctgcagtattcccggcggcgtgtgggagagttggagcgggctctc
tctgctgtctccacgcagcagaagaaggcagacaggtacaacaaggagttaaccaaagag
agagacgccctcaggctggagttatacaagaacacccaaagcaatgaggacctgaagcaa
gagaaatcagaattggaagagaagcttcgggtcctagtgactgagaaggctggcatgcag
cttaacttggaagaattgcaaaagaagttagagatgacggaactcctgcttcaacagttt
tcaagccggtgtgaagcccctgatgctaaccagcagttacagcaggccatggaggagcgg
gcacagctggaagcacacctggggcaggtaatggagtcggttagacaactacaaatggag
agagataaatatgcggagaatctcaaaggagagagcgccatgtggcggcagaggatgcag
cagatgtcagagcaggtgcacacattgagagaggagaaggaatgtagcatgagtcgggta
caggagctggagacgagcttggctgaactgaggaaccagatggctgaacccccgccccca
gagcccccagcagggccctccgaggtggagcagcagctacaagcggaggctgagcacctg
cggaaggagctggagggtctggcaggacagcttcaagcccaggtgcaagacaatgagggc
ttgagtcgcctgaaccgggagcaggaggagaggctgctggagctggagcgggcggccgag
ctctggggggagcaggcggaggcgcgcaggcaaatcctggagaccatgcagaacgaccgc
actaccatcagccgcgcactctcccagaaccgggagctcaaggagcagctggctgagctg
cagagcggatttgtaaagctgactaatgagaacatggagatcaccagcgcactgcagtcg
gagcagcacgtcaagagggagctgggaaagaagctgggcgagctgcaggagaagctgagc
gagctgaaggaaacggtggagctgaagagccaagaggctcaaagtctgcagcagcagcga
gaccagtacctgggacacctgcagcagtatgtggccgcctatcagcagctgacctctgag
aaggaggtgctgcataatcagctactgctgcagacccagctcgtggaccagctgcagcag
caggaagctcagggcaaagcggtggccgagatggcccgccaagagttgcaggaaacccag
gagcgcctggaagctgccacccagcagaatcagcagctacgggcccagttgagcctcatg
gctcaccctggggaaggagatggactggaccgggaggaggaggaggatgaggaggaggag
gaggaggaggcggtggcagtacctcagcccatgccaagcatcccggaggacctggagagc
cgggaagccatggtggcatttttcaactcagctgtagccagtgccgaggaggagcaggca
aggctacgtgggcagctgaaggagcaaagggtgcgctgccggcgcctggctcacctgctg
gcctcggcccagaaggagcctgaggcagcagccccagccccagggaccgggggtgattct
gtgtgtggggagacccaccgggccctgcagggggccatggagaagctgcagagccgcttt
atggagctcatgcaggagaaggcagacctgaaggagagggtagaggaactggaacatcgc
tgcatccagctttctggagagacagacaccattggagagtacattgcactgtaccagagc
cagagggcagtgctgaaggagcggcaccgggagaaggaggagtacatcagcaggctggcc
caagacaaggaggagatgaaggtgaagctgctggagctgcaggagctggtcttacggctt
gtgggcgaccgcaacgagtggcatggcagattcctggcagctgcccagaaccctgctgat
gagcccacttcaggggccccagccccccaggaacttggggctgccaaccagcagggtgat
ctttgcgaggtgagcctcgccggcagtgtggagcctgcccaaggagaggccagggagggt
tctccccgtgacaaccccactgcacagcagatcatgcagctgcttcgtgagatgcagaac
ccccgggagcgcccaggcttgggcagcaacccctgcattccttttttttaccgggctgac
gagaatgatgaggtgaagatcactgtcatctaa

DBGET integrated database retrieval system