KEGG   Homo sapiens (human): 2804
Entry
2804              CDS       T01001                                 

Gene name
GOLGB1, GCP, GCP372, GOLIM1
Definition
(RefSeq) golgin B1
  KO
K20478  golgin subfamily B member 1
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    2804 (GOLGB1)
Membrane trafficking [BR:hsa04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Retrieval pathways
   Rab associated proteins
    2804 (GOLGB1)
SSDB
Motif
Pfam: Crescentin Metal_resist HALZ
Other DBs
NCBI-GeneID: 2804
NCBI-ProteinID: NP_004478
OMIM: 602500
HGNC: 4429
Ensembl: ENSG00000173230
Vega: OTTHUMG00000159411
Pharos: Q14789(Tbio)
UniProt: Q14789
Position
3q13.33
AA seq 3259 aa
MLSRLSGLANVVLHELSGDDDTDQNMRAPLDPELHQESDMEFNNTTQEDVQERLAYAEQL
VVELKDIIRQKDVQLQQKDEALQEERKAADNKIKKLKLHAKAKLTSLNKYIEEMKAQGGT
VLPTEPQSEEQLSKHDKSSTEEEMEIEKIKHKLQEKEELISTLQAQLTQAQAEQPAQSST
EMEEFVMMKQQLQEKEEFISTLQAQLSQTQAEQAAQQVVREKDARFETQVRLHEDELLQL
VTQADVETEMQQKLRVLQRKLEEHEESLVGRAQVVDLLQQELTAAEQRNQILSQQLQQME
AEHNTLRNTVETEREESKILLEKMELEVAERKLSFHNLQEEMHHLLEQFEQAGQAQAELE
SRYSALEQKHKAEMEEKTSHILSLQKTGQELQSACDALKDQNSKLLQDKNEQAVQSAQTI
QQLEDQLQQKSKEISQFLNRLPLQQHETASQTSFPDVYNEGTQAVTEENIASLQKRVVEL
ENEKGALLLSSIELEELKAENEKLSSQITLLEAQNRTGEADREVSEISIVDIANKRSSSA
EESGQDVLENTFSQKHKELSVLLLEMKEAQEEIAFLKLQLQGKRAEEADHEVLDQKEMKQ
MEGEGIAPIKMKVFLEDTGQDFPLMPNEESSLPAVEKEQASTEHQSRTSEEISLNDAGVE
LKSTKQDGDKSLSAVPDIGQCHQDELERLKSQILELELNFHKAQEIYEKNLDEKAKEISN
LNQLIEEFKKNADNNSSAFTALSEERDQLLSQVKELSMVTELRAQVKQLEMNLAEAERQR
RLDYESQTAHDNLLTEQIHSLSIEAKSKDVKIEVLQNELDDVQLQFSEQSTLIRSLQSQL
QNKESEVLEGAERVRHISSKVEELSQALSQKELEITKMDQLLLEKKRDVETLQQTIEEKD
QQVTEISFSMTEKMVQLNEEKFSLGVEIKTLKEQLNLLSRAEEAKKEQVEEDNEVSSGLK
QNYDEMSPAGQISKEELQHEFDLLKKENEQRKRKLQAALINRKELLQRVSRLEEELANLK
DESKKEIPLSETERGEVEEDKENKEYSEKCVTSKCQEIEIYLKQTISEKEVELQHIRKDL
EEKLAAEEQFQALVKQMNQTLQDKTNQIDLLQAEISENQAIIQKLITSNTDASDGDSVAL
VKETVVISPPCTGSSEHWKPELEEKILALEKEKEQLQKKLQEALTSRKAILKKAQEKERH
LREELKQQKDDYNRLQEQFDEQSKENENIGDQLRQLQIQVRESIDGKLPSTDQQESCSST
PGLEEPLFKATEQHHTQPVLESNLCPDWPSHSEDASALQGGTSVAQIKAQLKEIEAEKVE
LELKVSSTTSELTKKSEEVFQLQEQINKQGLEIESLKTVSHEAEVHAESLQQKLESSQLQ
IAGLEHLRELQPKLDELQKLISKKEEDVSYLSGQLSEKEAALTKIQTEIIEQEDLIKALH
TQLEMQAKEHDERIKQLQVELCEMKQKPEEIGEESRAKQQIQRKLQAALISRKEALKENK
SLQEELSLARGTIERLTKSLADVESQVSAQNKEKDTVLGRLALLQEERDKLITEMDRSLL
ENQSLSSSCESLKLALEGLTEDKEKLVKEIESLKSSKIAESTEWQEKHKELQKEYEILLQ
SYENVSNEAERIQHVVEAVRQEKQELYGKLRSTEANKKETEKQLQEAEQEMEEMKEKMRK
FAKSKQQKILELEEENDRLRAEVHPAGDTAKECMETLLSSNASMKEELERVKMEYETLSK
KFQSLMSEKDSLSEEVQDLKHQIEGNVSKQANLEATEKHDNQTNVTEEGTQSIPGETEEQ
DSLSMSTRPTCSESVPSAKSANPAVSKDFSSHDEINNYLQQIDQLKERIAGLEEEKQKNK
EFSQTLENEKNTLLSQISTKDGELKMLQEEVTKMNLLNQQIQEELSRVTKLKETAEEEKD
DLEERLMNQLAELNGSIGNYCQDVTDAQIKNELLESEMKNLKKCVSELEEEKQQLVKEKT
KVESEIRKEYLEKIQGAQKEPGNKSHAKELQELLKEKQQEVKQLQKDCIRYQEKISALER
TVKALEFVQTESQKDLEITKENLAQAVEHRKKAQAELASFKVLLDDTQSEAARVLADNLK
LKKELQSNKESVKSQMKQKDEDLERRLEQAEEKHLKEKKNMQEKLDALRREKVHLEETIG
EIQVTLNKKDKEVQQLQENLDSTVTQLAAFTKSMSSLQDDRDRVIDEAKKWERKFSDAIQ
SKEEEIRLKEDNCSVLKDQLRQMSIHMEELKINISRLEHDKQIWESKAQTEVQLQQKVCD
TLQGENKELLSQLEETRHLYHSSQNELAKLESELKSLKDQLTDLSNSLEKCKEQKGNLEG
IIRQQEADIQNSKFSYEQLETDLQASRELTSRLHEEINMKEQKIISLLSGKEEAIQVAIA
ELRQQHDKEIKELENLLSQEEEENIVLEEENKKAVDKTNQLMETLKTIKKENIQQKAQLD
SFVKSMSSLQNDRDRIVGDYQQLEERHLSIILEKDQLIQEAAAENNKLKEEIRGLRSHMD
DLNSENAKLDAELIQYREDLNQVITIKDSQQKQLLEVQLQQNKELENKYAKLEEKLKESE
EANEDLRRSFNALQEEKQDLSKEIESLKVSISQLTRQVTALQEEGTLGLYHAQLKVKEEE
VHRLSALFSSSQKRIAELEEELVCVQKEAAKKVGEIEDKLKKELKHLHHDAGIMRNETET
AEERVAELARDLVEMEQKLLMVTKENKGLTAQIQSFGRSMSSLQNSRDHANEELDELKRK
YDASLKELAQLKEQGLLNRERDALLSETAFSMNSTEENSLSHLEKLNQQLLSKDEQLLHL
SSQLEDSYNQVQSFSKAMASLQNERDHLWNELEKFRKSEEGKQRSAAQPSTSPAEVQSLK
KAMSSLQNDRDRLLKELKNLQQQYLQINQEITELHPLKAQLQEYQDKTKAFQIMQEELRQ
ENLSWQHELHQLRMEKSSWEIHERRMKEQYLMAISDKDQQLSHLQNLIRELRSSSSQTQP
LKVQYQRQASPETSASPDGSQNLVYETELLRTQLNDSLKEIHQKELRIQQLNSNFSQLLE
EKNTLSIQLCDTSQSLRENQQHYGDLLNHCAVLEKQVQELQAGPLNIDVAPGAPQEKNGV
HRKSDPEELREPQQSFSEAQQQLCNTRQEVNELRKLLEEERDQRVAAENALSVAEEQIRR
LEHSEWDSSRTPIIGSCGTQEQALLIDLTSNSCRRTRSGVGWKRVLRSLCHSRTRVPLLA
AIYFLMIHVLLILCFTGHL
NT seq 9780 nt   +upstreamnt  +downstreamnt
atgctgagccgattatcaggattagcaaatgttgttttgcatgaattatcaggagatgat
gacactgatcagaatatgagggctcccctagaccctgaattacaccaagaatctgacatg
gaatttaataatactacacaagaagatgttcaggagcgcctggcttatgcagagcaattg
gtggtggagctaaaagatattattagacagaaggatgttcaactgcagcagaaagatgaa
gctctacaggaagagagaaaagctgctgataacaaaattaaaaaactaaaacttcatgcg
aaggccaaattaacttctttgaataaatacatagaagaaatgaaagcacaaggagggact
gttctgcctacagaacctcagtcagaggagcaactttccaagcatgacaagagttctaca
gaggaagagatggaaatagaaaagataaaacataagctccaggagaaggaggaactaatc
agcactttgcaagcccagcttactcaggcacaggcagaacaacctgcacagagttctaca
gagatggaagaatttgtaatgatgaagcaacagctccaggagaaggaagaattcattagc
actttacaagcccagctcagccagacacaggcagagcaagctgcacagcaggtggtccga
gagaaagatgcccgctttgaaacacaagttcgtcttcatgaagatgagcttcttcagtta
gtaacccaggcagatgtggaaacagagatgcaacagaaattgagggtgctgcaaaggaag
cttgaggaacacgaagaatccttggtgggccgtgctcaggtcgttgacttgctgcaacag
gagctgactgctgctgagcagagaaaccagattctctctcagcagttacagcagatggaa
gctgagcataatactttgaggaacactgtggaaacagaaagagaggagtccaagattcta
ctggaaaagatggaacttgaagtggcagagagaaaattatccttccataatctgcaggaa
gaaatgcatcatcttttagaacagtttgagcaagcaggccaagcccaggctgaactagag
tctcggtatagtgctttggagcagaagcacaaagcagaaatggaagagaagacctctcat
attttgagtcttcaaaagactggacaagagctgcagtctgcctgtgatgctctaaaggat
caaaattcaaagcttctccaagataagaatgagcaagcagttcagtcagcccagaccatt
cagcaactggaagatcagctccagcaaaaatccaaagaaattagccaatttctaaataga
ctgcccttgcaacaacatgaaacagcatctcagacttctttcccagatgtttataatgag
ggcacacaggcagtcactgaggagaatattgcttctttgcagaagagagtggtagaacta
gagaatgaaaagggagccttgctccttagttctatagagctggaggagctgaaagctgag
aatgaaaaactgtcttctcagattactctcctagaggctcagaatagaactggggaggca
gacagagaagtcagtgagatcagcattgttgatattgccaacaagaggagctcttctgct
gaggaaagtggacaagatgttctagaaaacacattttctcagaaacataaagaattatca
gttttattgttggaaatgaaagaagctcaagaggaaattgcatttcttaaattacagctc
cagggaaaaagggctgaggaagcagatcatgaggtccttgaccagaaagaaatgaaacag
atggagggtgagggaatagctccaattaaaatgaaagtatttcttgaagatacagggcaa
gattttcccttaatgccaaatgaagagagcagtcttccagcagttgaaaaagaacaggcg
agcactgaacatcaaagtagaacatctgaggaaatatctttaaatgatgctggagtagaa
ttgaaatcaacaaagcaggatggtgataaatccctttctgctgtaccagatattggtcag
tgtcatcaggatgagttggaaaggttaaaaagtcaaattttggagctcgagctaaacttt
cataaagcacaagaaatctatgagaaaaatttagatgagaaagctaaggaaattagcaac
ctaaaccagttgattgaggagtttaagaaaaatgctgacaacaacagcagtgcattcact
gctttgtctgaagaaagagaccagcttctctctcaggtgaaggaacttagcatggtaaca
gaattgagggctcaggtaaagcaactggaaatgaaccttgcagaagcagaaaggcaaaga
agacttgattatgaaagccaaactgcccatgacaacctgctcactgaacagatccatagt
ctcagcatagaagccaaatctaaagatgtgaaaattgaagttttacagaatgaactggat
gatgtgcagcttcagttttctgagcagagtaccctgataagaagcctgcaaagccagctg
caaaataaggaaagtgaagtgcttgagggggcagaacgtgtaaggcatatctcaagtaaa
gtggaagaactgtcccaggctctttcacagaaggaacttgaaataacaaaaatggatcag
ctcttactagagaaaaagagagatgtggaaaccctccaacaaaccatcgaggagaaggat
caacaagtgacagaaatcagctttagtatgactgagaaaatggttcagcttaatgaagag
aagttttctcttggggttgaaattaagactcttaaagaacagctaaatttattatccaga
gctgaggaagcaaaaaaagagcaggtggaagaagataatgaagtttcttctggccttaaa
caaaattatgatgagatgagcccagcaggacaaataagtaaggaagaacttcagcatgaa
tttgaccttctgaagaaagaaaatgagcagagaaagagaaagctccaggcagctcttatt
aacagaaaggagcttctgcaaagagtcagtagattggaagaagaattagccaacttgaaa
gatgaatctaagaaagaaatcccactcagtgagactgagaggggagaagtggaagaagat
aaagaaaacaaagaatactcagaaaaatgtgtgacttctaagtgccaagaaatagaaatt
tatttaaaacagacaatatctgagaaagaagtggaactacagcatataaggaaggatttg
gaagaaaagctggcagctgaagagcaattccaggctctggtcaaacagatgaatcagacc
ttgcaagataaaacaaaccaaatagatttgctccaagcagaaatcagtgaaaaccaagca
attatccagaagttaatcacaagtaacacggatgcaagtgatggggactccgtagcactt
gtaaaggaaacagtggtgataagtccaccttgtacaggtagtagtgaacactggaaacca
gaactagaagaaaagatactggcccttgaaaaagaaaaggagcaacttcaaaagaagcta
caggaagccttaacctcccgcaaggcaattcttaaaaaggcacaggagaaagaaagacat
ctcagggaggagctaaagcaacagaaagatgactataatcgcttgcaagaacagtttgat
gagcaaagcaaggaaaatgagaatattggagaccagctaaggcaactccagattcaagta
agggaatccatagacggaaaactcccaagcacagaccagcaggaatcgtgttcttccact
ccaggtttagaagaacctttattcaaagccacagaacagcatcacactcaacctgtttta
gagtccaacttgtgcccagactggccttctcattctgaagatgcgagtgctctgcagggc
ggaacttctgttgcccagattaaggcccagctgaaggaaatagaggctgagaaagtagag
ttagaattgaaagttagttctacaacaagtgagcttactaaaaaatcagaagaggtattt
cagttacaagagcagataaataaacagggtttagaaatcgagagtctaaagacagtatcc
catgaagctgaagtccatgccgaaagcctgcagcagaaattggaaagcagccaactacaa
attgctggcctagaacatctaagagaattgcaacctaaactggatgaactgcaaaaactc
ataagcaaaaaggaagaagacgttagctacctttctggacaacttagtgagaaagaagca
gctctcactaaaatacagacagagataatagaacaagaagatttaattaaggctctgcat
acacagctagaaatgcaagccaaagagcatgatgagaggataaagcagctacaggtggaa
ctttgtgaaatgaagcaaaaaccagaagagattggagaagaaagtagagcaaagcaacaa
atacaaaggaaactgcaagctgcccttatttcccgaaaagaagcactaaaagaaaacaaa
agtctccaagaggaattgtctttggccagaggtaccattgaacgtctcaccaagtctctg
gcagatgtggaaagccaagtttctgctcaaaataaagaaaaagatacggtcttaggaagg
ttagctcttcttcaagaagaaagagacaaactcattacagaaatggacaggtctttattg
gaaaatcagagtctcagcagctcctgtgaaagtctaaaactagctctagagggtcttact
gaagacaaggaaaagttagtgaaggaaattgaatctttgaaatcttctaagattgcagaa
agtactgagtggcaagagaaacacaaggagctacaaaaagagtatgaaattcttctgcag
tcctatgagaatgttagtaatgaagcagaaaggattcagcatgtggtggaagctgtgagg
caagagaaacaagaactgtatggcaagttaagaagcacagaggcaaacaagaaggagaca
gaaaagcagttgcaggaagctgagcaagaaatggaggaaatgaaagaaaagatgagaaag
tttgctaaatctaaacagcagaaaatcctagagctggaagaagagaatgaccggcttagg
gcagaggtgcaccctgcaggagatacagctaaagagtgtatggaaacacttctttcttcc
aatgccagcatgaaggaagaacttgaaagggtcaaaatggagtatgaaaccctttctaag
aagtttcagtctttaatgtctgagaaagactctctaagtgaagaggttcaagatttaaag
catcagatagaaggtaatgtatctaaacaagctaacctagaggccaccgagaaacatgat
aaccaaacgaatgtcactgaagagggaacacagtctataccaggtgagactgaagagcaa
gactctctgagtatgagcacaagacctacatgttcagaatcggttccatcagcgaagagt
gccaaccctgctgtaagtaaggatttcagctcacatgatgaaattaataactacctacag
cagattgatcagctcaaagaaagaattgctggattagaggaggagaagcagaaaaacaag
gaatttagccagactttagaaaatgagaaaaataccttactgagtcagatatcaacaaag
gatggtgaactaaaaatgcttcaggaggaagtaaccaaaatgaacctgttaaatcagcaa
atccaagaagaactctccagagttaccaaactaaaggagacagcagaagaagagaaagat
gatttggaagagaggcttatgaatcaattagcagaacttaatggaagcattgggaattac
tgtcaggatgttacagatgcccaaataaaaaatgagctattggaatctgaaatgaagaac
cttaaaaagtgtgtgagtgaattggaagaagaaaagcagcagttagtcaaggaaaaaact
aaggtggaatcagaaatacgaaaggaatatttggagaaaatacaaggtgctcagaaagaa
cccggaaataaaagccatgcaaaggaacttcaggaactgttaaaagaaaaacaacaagaa
gtaaagcagctacagaaggactgcatcaggtatcaagagaaaattagtgctctggagaga
actgttaaagctctagaatttgttcaaactgaatctcaaaaagatttggaaataaccaaa
gaaaatctggctcaagcagttgaacaccgcaaaaaggcacaagcagaattagctagcttc
aaagtcctgctagatgacactcaaagtgaagcagcaagggtcctagcagacaatctcaag
ttgaaaaaggaacttcagtcaaataaagaatcagttaaaagccagatgaaacaaaaggat
gaagatcttgagcgaagactggaacaggcagaagagaagcacctgaaagagaagaagaat
atgcaagagaaactggatgctttgcgcagagaaaaagtccacttggaagagacaattgga
gagattcaggttactttgaacaagaaagacaaggaagttcagcaacttcaggaaaacttg
gacagtactgtgacccagcttgcagcctttactaagagcatgtcttccctccaggatgat
cgtgacagggtgatagatgaagctaagaaatgggagaggaagtttagtgatgcgattcaa
agcaaagaagaagaaattagactcaaagaagataattgcagtgttctaaaggatcaactt
agacagatgtccatccatatggaagaattaaagattaacatttccaggcttgaacatgac
aagcagatttgggagtccaaggcccagacagaggtccagcttcagcagaaggtctgtgat
actctacagggggaaaacaaagaacttttgtcccagctagaagagacacgccacctatac
cacagttctcagaatgaattagctaagttggaatcagaacttaagagtctcaaagaccag
ttgactgatttaagtaactctttagaaaaatgtaaggaacaaaaaggaaacttggaaggg
atcataaggcagcaagaggctgatattcaaaattctaagttcagttatgaacaactggag
actgatcttcaggcctccagagaactgaccagtaggctgcatgaagaaataaatatgaaa
gagcaaaagattataagcctgctttctggcaaggaagaggcaatccaagtagctattgct
gaactgcgtcagcaacatgataaagaaattaaagagctggaaaacctgctgtcccaggag
gaagaggagaatattgttttagaagaggagaacaaaaaggctgttgataaaaccaatcag
cttatggaaacactgaaaaccatcaaaaaggaaaacattcagcaaaaggcacagttggat
tcctttgttaaatccatgtcttctctccaaaatgatcgagaccgcatagtgggtgactat
caacagctggaagagcgacatctctctataatcttggaaaaagaccaactcatccaagag
gctgctgcagagaataataagcttaaagaagaaatacgaggcttgagaagtcatatggat
gatctcaattctgagaatgccaagctagatgcagaactgatccaatatagagaagacctg
aaccaagtgataacaataaaggacagccaacaaaagcagcttcttgaagttcaacttcag
caaaataaggagctggaaaataaatatgctaaattagaagaaaagctgaaggaatctgag
gaagcaaatgaggatctgcggaggtcctttaatgccctacaagaagagaaacaagattta
tctaaagagattgagagtttgaaagtatctatatcccagctaacaagacaagtaacagcc
ttgcaagaagaaggtactttaggactctatcatgcccagttaaaagtaaaagaagaagag
gtacacaggttaagtgctttgttttcctcctctcaaaagagaattgcagaactggaagaa
gaattggtttgtgttcaaaaggaagctgccaagaaggtaggtgaaattgaagataaactg
aagaaagaattaaagcatcttcatcatgatgcagggataatgagaaatgaaactgaaaca
gcagaagagagagtggcagagctagcaagagatttggtggagatggaacagaaattactc
atggtcaccaaagaaaataaaggtctcacagcacaaattcagtcttttggaaggtctatg
agttccttgcaaaatagtagagatcatgccaatgaggaacttgatgaactgaaaaggaaa
tatgatgccagtctgaaggaattggcacagttgaaagaacagggactcttaaacagagag
agagatgctcttctttctgaaaccgccttttcaatgaactccactgaggagaatagcttg
tctcaccttgagaaacttaaccaacagctcctatccaaagatgagcaattgcttcacttg
tcctcacaactagaagattcttataaccaagtgcagtccttttccaaggctatggccagt
ctgcagaatgagagagatcacctgtggaatgagctggagaaatttcgaaagtcagaggaa
gggaagcagaggtctgcagctcagccttccaccagcccagctgaagtacagagtttaaaa
aaagctatgtcttcactccaaaatgacagagacagactactgaaggaattgaagaatctg
cagcagcaatacttacagattaatcaagagatcactgagttacatccactgaaggctcaa
cttcaggagtatcaagataagacaaaagcatttcagattatgcaagaagagctcaggcag
gaaaacctctcctggcagcatgagctgcatcagctcaggatggagaagagttcctgggaa
atacatgagaggagaatgaaggaacagtaccttatggctatctcagataaagatcagcag
ctcagtcatctgcagaatcttataagggaattgaggtcttcttcctcccagactcagcct
ctcaaagtgcaataccaaagacaggcatccccagagacatcagcttccccagatgggtca
caaaatctggtttatgagacagaacttctcaggacccagctcaatgacagcttaaaggaa
attcaccaaaaggagttaagaattcagcaactgaacagcaacttctctcagctactggaa
gagaaaaacaccctttccattcagctctgcgataccagtcagagtcttcgtgagaaccag
cagcactatggtgaccttttaaatcactgtgcagtcttggagaagcaggttcaagagctg
caggcggggccactaaatatagatgttgctccaggagctccccaggaaaagaatggagtt
cacagaaagagtgaccctgaggaactaagggaaccgcagcaaagcttttctgaagctcag
cagcagctatgcaacaccagacaggaagtgaatgaattaaggaagctgctggaagaagaa
cgagaccaaagagtggctgctgagaatgctctctctgtggccgaggagcagatcagacgg
ttagagcacagtgaatgggactcttcccggactcctatcattggctcctgtggcactcag
gagcaggcactgttaatagatcttacaagcaacagttgtcgaaggacccggagtggcgtt
ggatggaagcgagtcctgcgttcactctgtcattcacggacccgagtgccacttctagca
gccatctactttctaatgattcatgtcctgctcattctgtgttttacgggccatctatag

DBGET integrated database retrieval system