KEGG   Homo sapiens (human): 2805
Entry
2805              CDS       T01001                                 

Gene name
GOT1, AST1, ASTQTL1, GIG18, cAspAT, cCAT
Definition
(RefSeq) glutamic-oxaloacetic transaminase 1
  KO
K14454  aspartate aminotransferase, cytoplasmic [EC:2.6.1.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00220  Arginine biosynthesis
hsa00250  Alanine, aspartate and glutamate metabolism
hsa00270  Cysteine and methionine metabolism
hsa00330  Arginine and proline metabolism
hsa00350  Tyrosine metabolism
hsa00360  Phenylalanine metabolism
hsa00400  Phenylalanine, tyrosine and tryptophan biosynthesis
hsa01100  Metabolic pathways
hsa01200  Carbon metabolism
hsa01210  2-Oxocarboxylic acid metabolism
hsa01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    2805 (GOT1)
   00270 Cysteine and methionine metabolism
    2805 (GOT1)
   00220 Arginine biosynthesis
    2805 (GOT1)
   00330 Arginine and proline metabolism
    2805 (GOT1)
   00350 Tyrosine metabolism
    2805 (GOT1)
   00360 Phenylalanine metabolism
    2805 (GOT1)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    2805 (GOT1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:hsa01007]
    2805 (GOT1)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    2805 (GOT1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    2805 (GOT1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.1  aspartate transaminase
     2805 (GOT1)
Amino acid related enzymes [BR:hsa01007]
 Aminotransferase (transaminase)
  Class I
   2805 (GOT1)
Membrane trafficking [BR:hsa04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    2805 (GOT1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   2805 (GOT1)
  Exosomal proteins of other body fluids (saliva and urine)
   2805 (GOT1)
SSDB
Motif
Pfam: Aminotran_1_2
Other DBs
NCBI-GeneID: 2805
NCBI-ProteinID: NP_002070
OMIM: 138180
HGNC: 4432
Ensembl: ENSG00000120053
Vega: OTTHUMG00000018882
Pharos: P17174(Tbio)
UniProt: P17174 A0A140VK69
Structure
PDB: 
6DNB 3II0 6DND 3WZF 6DNA

Position
10q24.2
AA seq 413 aa
MAPPSVFAEVPQAQPVLVFKLTADFREDPDPRKVNLGVGAYRTDDCHPWVLPVVKKVEQK
IANDNSLNHEYLPILGLAEFRSCASRLALGDDSPALKEKRVGGVQSLGGTGALRIGADFL
ARWYNGTNNKNTPVYVSSPTWENHNAVFSAAGFKDIRSYRYWDAEKRGLDLQGFLNDLEN
APEFSIVVLHACAHNPTGIDPTPEQWKQIASVMKHRFLFPFFDSAYQGFASGNLERDAWA
IRYFVSEGFEFFCAQSFSKNFGLYNERVGNLTVVGKEPESILQVLSQMEKIVRITWSNPP
AQGARIVASTLSNPELFEEWTGNVKTMADRILTMRSELRARLEALKTPGTWNHITDQIGM
FSFTGLNPKQVEYLVNEKHIYLLPSGRINVSGLTTKNLDYVATSIHEAVTKIQ
NT seq 1242 nt   +upstreamnt  +downstreamnt
atggcacctccgtcagtctttgccgaggttccgcaggcccagcctgtcctggtcttcaag
ctcactgccgacttcagggaggatccggacccccgcaaggtcaacctgggagtgggagca
tatcgcacggatgactgccatccctgggttttgccagtagtgaagaaagtggagcagaag
attgctaatgacaatagcctaaatcacgagtatctgccaatcctgggcctggctgagttc
cggagctgtgcttctcgtcttgcccttggggatgacagcccagcactcaaggagaagcgg
gtaggaggtgtgcaatctttggggggaacaggtgcacttcgaattggagctgatttctta
gcgcgttggtacaatggaacaaacaacaagaacacacctgtctatgtgtcctcaccaacc
tgggagaatcacaatgctgtgttttccgctgctggttttaaagacattcggtcctatcgc
tactgggatgcagagaagagaggattggacctccagggcttcctgaatgatctggagaat
gctcctgagttctccattgttgtcctccacgcctgtgcacacaacccaactgggattgac
ccaactccggagcagtggaagcagattgcttctgtcatgaagcaccggtttctgttcccc
ttctttgactcagcctatcagggcttcgcatctggaaacctggagagagatgcctgggcc
attcgctattttgtgtctgaaggcttcgagttcttctgtgcccagtccttctccaagaac
ttcgggctctacaatgagagagtcgggaatctgactgtggttggaaaagaacctgagagc
atcctgcaagtcctttcccagatggagaagatcgtgcggattacttggtccaatcccccc
gcccagggagcacgaattgtggccagcaccctctctaaccctgagctctttgaggaatgg
acaggtaatgtgaagacaatggctgaccggattctgaccatgagatctgaactcagggca
cgactagaagccctcaaaacccctgggacctggaaccacatcactgatcaaattggcatg
ttcagcttcactgggttgaaccccaagcaggttgagtatctggtcaatgaaaagcacatc
tacctgctgccaagtggtcgaatcaacgtgagtggcttaaccaccaaaaatctagattac
gtggccacctccatccatgaagcagtcaccaaaatccagtga

DBGET integrated database retrieval system