KEGG   Homo sapiens (human): 2806Help
Entry
2806              CDS       T01001                                 

Gene name
GOT2, KAT4, KATIV, KYAT4, mitAAT
Definition
(RefSeq) glutamic-oxaloacetic transaminase 2
  KO
K14455  aspartate aminotransferase, mitochondrial [EC:2.6.1.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00220  Arginine biosynthesis
hsa00250  Alanine, aspartate and glutamate metabolism
hsa00270  Cysteine and methionine metabolism
hsa00330  Arginine and proline metabolism
hsa00350  Tyrosine metabolism
hsa00360  Phenylalanine metabolism
hsa00400  Phenylalanine, tyrosine and tryptophan biosynthesis
hsa01100  Metabolic pathways
hsa01200  Carbon metabolism
hsa01210  2-Oxocarboxylic acid metabolism
hsa01230  Biosynthesis of amino acids
hsa04975  Fat digestion and absorption
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    2806 (GOT2)
   00270 Cysteine and methionine metabolism
    2806 (GOT2)
   00220 Arginine biosynthesis
    2806 (GOT2)
   00330 Arginine and proline metabolism
    2806 (GOT2)
   00350 Tyrosine metabolism
    2806 (GOT2)
   00360 Phenylalanine metabolism
    2806 (GOT2)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    2806 (GOT2)
 09150 Organismal Systems
  09154 Digestive system
   04975 Fat digestion and absorption
    2806 (GOT2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:hsa01007]
    2806 (GOT2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.1  aspartate transaminase
     2806 (GOT2)
Amino acid related enzymes [BR:hsa01007]
 Aminotransferase (transaminase)
  Class I
   2806 (GOT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 2806
NCBI-ProteinID: NP_002071
OMIM: 138150
HGNC: 4433
Ensembl: ENSG00000125166
Vega: OTTHUMG00000133769
Pharos: P00505(Tbio)
UniProt: P00505
Structure
PDB: 

Position
16q21
AA seq 430 aa AA seqDB search
MALLHSGRVLPGIAAAFHPGLAAAASARASSWWTHVEMGPPDPILGVTEAFKRDTNSKKM
NLGVGAYRDDNGKPYVLPSVRKAEAQIAAKNLDKEYLPIGGLAEFCKASAELALGENSEV
LKSGRFVTVQTISGTGALRIGASFLQRFFKFSRDVFLPKPTWGNHTPIFRDAGMQLQGYR
YYDPKTCGFDFTGAVEDISKIPEQSVLLLHACAHNPTGVDPRPEQWKEIATVVKKRNLFA
FFDMAYQGFASGDGDKDAWAVRHFIEQGINVCLCQSYAKNMGLYGERVGAFTMVCKDADE
AKRVESQLKILIRPMYSNPPLNGARIAAAILNTPDLRKQWLQEVKVMADRIIGMRTQLVS
NLKKEGSTHNWQHITDQIGMFCFTGLKPEQVERLIKEFSIYMTKDGRISVAGVTSSNVGY
LAHAIHQVTK
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atggccctgctgcactccggccgcgtcctccccgggatcgccgccgccttccacccgggc
ctcgccgccgcggcctctgccagagccagctcctggtggacccatgtggaaatgggacct
ccagatcccattctgggagtcactgaagcctttaagagggacaccaatagcaaaaagatg
aatctgggagttggtgcctaccgggatgataatggaaagccttacgttctgcctagcgtc
cgcaaggcagaggcccagattgccgcaaaaaatttggacaaggaatacctgcccattggg
ggactggctgaattttgcaaggcatctgcagaactagccctgggtgagaacagcgaagtc
ttgaagagtggccggtttgtcactgtgcagaccatttctggaactggagccttaaggatc
ggagccagttttctgcaaagattttttaagttcagccgagatgtctttctgcccaaacca
acctggggaaaccacacacccatcttcagggatgctggcatgcagctacaaggttatcgg
tattatgaccccaagacttgcggttttgacttcacaggcgctgtggaggatatttcaaaa
ataccagagcagagtgttcttcttctgcatgcctgcgcccacaatcccacgggagtggac
ccgcgtccggaacagtggaaggaaatagcaacagtggtgaagaaaaggaatctctttgcg
ttctttgacatggcctaccaaggctttgccagtggtgatggtgataaggatgcctgggct
gtgcgccacttcatcgaacagggcattaatgtttgcctctgccaatcatatgccaagaac
atgggcttatatggtgagcgtgtaggagccttcactatggtctgcaaagatgcggatgaa
gccaaaagggtagagtcacagttgaagatcttgatccgtcccatgtattccaaccctccc
ctcaatggggcccggattgctgctgccattctgaacaccccagatttgcgaaaacaatgg
ctgcaagaagtgaaagtcatggctgaccgcatcattggcatgcggactcaactggtctcc
aacctcaagaaggagggttccacccacaattggcaacacatcaccgaccaaattggcatg
ttctgtttcacagggctaaagcctgaacaggtggagcggctgatcaaggagttctccatc
tacatgacaaaagatggccgcatctctgtggcaggggtcacctccagcaacgtgggctac
cttgcccatgccattcaccaggtcaccaagtaa

DBGET integrated database retrieval system