KEGG   Homo sapiens (human): 2811Help
Entry
2811              CDS       T01001                                 

Gene name
GP1BA, BDPLT1, BDPLT3, BSS, CD42B, CD42b-alpha, DBPLT3, GP1B, GPIbA, GPIbalpha, VWDP
Definition
(RefSeq) glycoprotein Ib platelet subunit alpha
  KO
K06261  platelet glycoprotein Ib alpha chain
Organism
hsa  Homo sapiens (human)
Pathway
hsa04512  ECM-receptor interaction
hsa04611  Platelet activation
hsa04640  Hematopoietic cell lineage
Disease
H00219  Hemophilia
H00224  Bernard-Soulier syndrome
H01740  Macrothrombocytopenia
H02093  Platelet-type von Willebrand disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    2811 (GP1BA)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    2811 (GP1BA)
   04611 Platelet activation
    2811 (GP1BA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    2811 (GP1BA)
CD molecules [BR:hsa04090]
 Proteins
  2811 (GP1BA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LRR_8 LRR_4 LRRNT LRR_9
Motif
Other DBs
NCBI-GeneID: 2811
NCBI-ProteinID: NP_000164
OMIM: 606672
HGNC: 4439
Ensembl: ENSG00000185245
Vega: OTTHUMG00000177946
Pharos: P07359(Tbio)
UniProt: P07359 L7UYB8
Structure
PDB: 

Position
17p13.2
AA seq 652 aa AA seqDB search
MPLLLLLLLLPSPLHPHPICEVSKVASHLEVNCDKRNLTALPPDLPKDTTILHLSENLLY
TFSLATLMPYTRLTQLNLDRCELTKLQVDGTLPVLGTLDLSHNQLQSLPLLGQTLPALTV
LDVSFNRLTSLPLGALRGLGELQELYLKGNELKTLPPGLLTPTPKLEKLSLANNNLTELP
AGLLNGLENLDTLLLQENSLYTIPKGFFGSHLLPFAFLHGNPWLCNCEILYFRRWLQDNA
ENVYVWKQGVDVKAMTSNVASVQCDNSDKFPVYKYPGKGCPTLGDEGDTDLYDYYPEEDT
EGDKVRATRTVVKFPTKAHTTPWGLFYSWSTASLDSQMPSSLHPTQESTKEQTTFPPRWT
PNFTLHMESITFSKTPKSTTEPTPSPTTSEPVPEPAPNMTTLEPTPSPTTPEPTSEPAPS
PTTPEPTSEPAPSPTTPEPTSEPAPSPTTPEPTPIPTIATSPTILVSATSLITPKSTFLT
TTKPVSLLESTKKTIPELDQPPKLRGVLQGHLESSRNDPFLHPDFCCLLPLGFYVLGLFW
LLFASVVLILLLSWVGHVKPQALDSGQGAALTTATQTTHLELQRGRQVTVPRAWLLFLRG
SLPTFRSSLFLWVRPNGRVGPLVAGRRPSALSQGRGQDLLSTVSIRYSGHSL
NT seq 1959 nt NT seq  +upstreamnt  +downstreamnt
atgcctctcctcctcttgctgctcctgctgccaagccccttacacccccaccccatctgt
gaggtctccaaagtggccagccacctagaagtgaactgtgacaagaggaatctgacagcg
ctgcctccagacctgccgaaagacacaaccatcctccacctgagtgagaacctcctgtac
accttctccctggcaaccctgatgccttacactcgcctcactcagctgaacctagatagg
tgcgagctcaccaagctccaggtcgatgggacgctgccagtgctggggaccctggatcta
tcccacaatcagctgcaaagcctgcccttgctagggcagacactgcctgctctcaccgtc
ctggacgtctccttcaaccggctgacctcgctgcctcttggtgccctgcgtggtcttggc
gaactccaagagctctacctgaaaggcaatgagctgaagaccctgcccccagggctcctg
acgcccacacccaagctggagaagctcagtctggctaacaacaacttgactgagctcccc
gctgggctcctgaatgggctggagaatctcgacacccttctcctccaagagaactcgctg
tatacaataccaaagggcttttttgggtcccacctcctgccttttgcttttctccacggg
aacccctggttatgcaactgtgagatcctctattttcgtcgctggctgcaggacaatgct
gaaaatgtctacgtatggaagcaaggtgtggacgtcaaggccatgacctctaacgtggcc
agtgtgcagtgtgacaattcagacaagtttcccgtctacaaatacccaggaaaggggtgc
cccacccttggtgatgaaggtgacacagacctatatgattactacccagaagaggacact
gagggcgataaggtgcgtgccacaaggactgtggtcaagttccccaccaaagcccataca
accccctggggtctattctactcatggtccactgcttctctagacagccaaatgccctcc
tccttgcatccaacacaagaatccactaaggagcagaccacattcccacctagatggacc
ccaaatttcacacttcacatggaatccatcacattctccaaaactccaaaatccactact
gaaccaaccccaagcccgaccacctcagagcccgtcccggagcccgccccaaacatgacc
accctggagcccactccaagcccgaccaccccagagcccacctcagagcccgcccccagc
ccgaccaccccggagcccacctcagagcccgcccccagcccgaccaccccagagcccacc
tcagagcccgcccccagcccgaccaccccggagcccaccccaatcccgaccatcgccaca
agcccgaccatcctggtgtctgccacaagcctgatcactccaaaaagcacatttttaact
accacaaaacccgtatcactcttagaatccaccaaaaaaaccatccctgaacttgatcag
ccaccaaagctccgtggggtgctccaagggcatttggagagctccagaaatgaccctttt
ctccaccccgacttttgctgcctcctccccctgggcttctatgtcttgggtctcttctgg
ctgctctttgcctctgtggtcctcatcctgctgctgagctgggttgggcatgtgaaacca
caggccctggactctggccaaggtgctgctctgaccacagccacacaaaccacacacctg
gagctgcagaggggacggcaagtgacagtgccccgggcctggctgctcttccttcgaggt
tcgcttcccactttccgctccagcctcttcctgtgggtacggcctaatggccgtgtgggg
cctctagtggcaggaaggaggccctcagctctgagtcagggtcgtggtcaggacctgctg
agcacagtgagcattaggtactctggccacagcctctga

DBGET integrated database retrieval system