KEGG   Homo sapiens (human): 2813Help
Entry
2813              CDS       T01001                                 

Gene name
GP2, ZAP75
Definition
(RefSeq) glycoprotein 2
  KO
K19899  pancreatic secretory granule membrane major glycoprotein GP2
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
    2813 (GP2)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
 Others
  2813 (GP2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Zona_pellucida
Motif
Other DBs
NCBI-GeneID: 2813
NCBI-ProteinID: NP_001007241
OMIM: 602977
HGNC: 4441
Ensembl: ENSG00000169347
Vega: OTTHUMG00000131489
Pharos: P55259(Tbio)
UniProt: P55259 B7Z1G2
Position
16p12.3
AA seq 537 aa AA seqDB search
MPHLMERMVGSGLLWLALVSCILTQASAVQRGYGNPIEASSYGLDLDCGAPGTPEAHVCF
DPCQNYTLLDEPFRSTENSAGSQGCDKNMSGWYRFVGEGGVRMSETCVQVHRCQTDAPMW
LNGTHPALGDGITNHTACAHWSGNCCFWKTEVLVKACPGGYHVYRLEGTPWCNLRYCTVP
RDPSTVEDKCEKACRPEEECLALNSTWGCFCRQDLNSSDVHSLQPQLDCGPREIKVKVDK
CLLGGLGLGEEVIAYLRDPNCSSILQTEERNWVSVTSPVQASACRNILERNQTHAIYKNT
LSLVNDFIIRDTILNINFQCAYPLDMKVSLQAALQPIVSSLNVSVDGNGEFIVRMALFQD
QNYTNPYEGDAVELSVESVLYVGAILEQGDTSRFNLVLRNCYATPTEDKADLVKYFIIRN
SCSNQRDSTIHVEENGQSSESRFSVQMFMFAGHYDLVFLHCEIHLCDSLNEQCQPSCSRS
QVRSEVPAIDLARVLDLGPITRRGAQSPGVMNGTPSTAGFLVAWPMVLLTVLLAWLF
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atgcctcaccttatggaaaggatggtgggctctggcctcctgtggctggccttggtctcc
tgcattctgacccaggcatctgcagtgcagcgaggttatggaaaccccattgaagccagt
tcgtatgggctggacctggactgcggagctcctggcaccccagaggctcatgtctgtttt
gacccctgtcagaattacaccctcctggatgaacccttccgaagcacagagaactcagca
gggtcccaggggtgcgataaaaacatgagcggctggtaccgctttgtaggggaaggagga
gtaaggatgtcggagacctgtgtccaggtgcaccgatgccagacagacgctcccatgtgg
ctgaatgggacccaccctgcccttggggatggcatcaccaaccacactgcctgtgcccat
tggagtggcaactgctgtttctggaaaacagaggtgctggtgaaggcctgcccaggcggg
taccatgtgtaccggttggaaggcactccctggtgtaatctgagatactgcacagttcca
cgagacccatccactgtggaggacaagtgtgagaaggcctgccgccccgaggaggagtgc
cttgccctcaacagcacctggggctgtttctgcagacaggacctcaatagttctgatgtc
cacagtttgcagcctcagctagactgtgggcccagggagatcaaggtgaaggtggacaaa
tgtttgctgggaggcctgggtttgggggaggaggtcattgcctacctgcgagacccaaac
tgcagcagcatcttgcagacagaggagaggaactgggtatctgtgaccagccccgtccag
gctagtgcctgcaggaacattctggagagaaatcaaacccatgccatctacaaaaacacc
ctctccttggtcaatgatttcatcatcagagacaccatcctcaacatcaacttccaatgt
gcctacccactggacatgaaagtcagcctccaagctgccttgcagcccattgtaagttcc
ctgaacgtcagtgtggacgggaatggagagttcattgtcaggatggccctcttccaagac
cagaactacacgaatccttacgaaggggatgcagttgaactgtctgttgagtccgtgctg
tatgtgggtgccatcttggaacaaggggacacctcccggtttaacctggtgttgaggaac
tgctatgccacccccactgaagacaaggctgaccttgtgaagtatttcatcatcagaaac
agctgctcaaatcaacgtgattccaccatccacgtggaggagaatgggcagtcctcggaa
agccggttctcagttcagatgttcatgtttgctggacattatgacctagttttcctgcat
tgtgagattcatctctgtgattctcttaatgaacagtgccagccttcttgctcaagaagt
caagtccgcagtgaagtaccggccatcgacctagcccgggttctagatttggggcccatc
actcggagaggtgcacagtctcccggtgtcatgaatggaacccctagcactgcagggttc
ctggtggcctggcctatggtcctcctgactgtcctcctggcttggctgttctga

DBGET integrated database retrieval system