KEGG   Homo sapiens (human): 2817Help
Entry
2817              CDS       T01001                                 

Gene name
GPC1, glypican
Definition
(RefSeq) glypican 1
  KO
K08107  glypican 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa05205  Proteoglycans in cancer
hsa05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    2817 (GPC1)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    2817 (GPC1)
Proteoglycans [BR:hsa00535]
 Cell surface proteoglycans
  Glypican family (GPI-anchored HSPG)
   2817 (GPC1)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
 Others
  2817 (GPC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glypican
Motif
Other DBs
NCBI-GeneID: 2817
NCBI-ProteinID: NP_002072
OMIM: 600395
HGNC: 4449
Ensembl: ENSG00000063660
Vega: OTTHUMG00000133349
Pharos: P35052(Tbio)
UniProt: P35052
Structure
PDB: 

Position
2q37.3
AA seq 558 aa AA seqDB search
MELRARGWWLLCAAAALVACARGDPASKSRSCGEVRQIYGAKGFSLSDVPQAEISGEHLR
ICPQGYTCCTSEMEENLANRSHAELETALRDSSRVLQAMLATQLRSFDDHFQHLLNDSER
TLQATFPGAFGELYTQNARAFRDLYSELRLYYRGANLHLEETLAEFWARLLERLFKQLHP
QLLLPDDYLDCLGKQAEALRPFGEAPRELRLRATRAFVAARSFVQGLGVASDVVRKVAQV
PLGPECSRAVMKLVYCAHCLGVPGARPCPDYCRNVLKGCLANQADLDAEWRNLLDSMVLI
TDKFWGTSGVESVIGSVHTWLAEAINALQDNRDTLTAKVIQGCGNPKVNPQGPGPEEKRR
RGKLAPRERPPSGTLEKLVSEAKAQLRDVQDFWISLPGTLCSEKMALSTASDDRCWNGMA
RGRYLPEVMGDGLANQINNPEVEVDITKPDMTIRQQIMQLKIMTNRLRSAYNGNDVDFQD
ASDDGSGSGSGDGCLDDLCSRKVSRKSSSSRTPLTHALPGLSEQEGQKTSAASCPQPPTF
LLPLLLFLALTVARPRWR
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
atggagctccgggcccgaggctggtggctgctatgtgcggccgcagcgctggtcgcctgc
gcccgcggggacccggccagcaagagccggagctgcggcgaggtccgccagatctacgga
gccaagggcttcagcctgagcgacgtgccccaggcggagatctcgggtgagcacctgcgg
atctgtccccagggctacacctgctgcaccagcgagatggaggagaacctggccaaccgc
agccatgccgagctggagaccgcgctccgggacagcagccgcgtcctgcaggccatgctt
gccacccagctgcgcagcttcgatgaccacttccagcacctgctgaacgactcggagcgg
acgctgcaggccaccttccccggcgccttcggagagctgtacacgcagaacgcgagggcc
ttccgggacctgtactcagagctgcgcctgtactaccgcggtgccaacctgcacctggag
gagacgctggccgagttctgggcccgcctgctcgagcgcctcttcaagcagctgcacccc
cagctgctgctgcctgatgactacctggactgcctgggcaagcaggccgaggcgctgcgg
cccttcggggaggccccgagagagctgcgcctgcgggccacccgtgccttcgtggctgct
cgctcctttgtgcagggcctgggcgtggccagcgacgtggtccggaaagtggctcaggtc
cccctgggcccggagtgctcgagagctgtcatgaagctggtctactgtgctcactgcctg
ggagtccccggcgccaggccctgccctgactattgccgaaatgtgctcaagggctgcctt
gccaaccaggccgacctggacgccgagtggaggaacctcctggactccatggtgctcatc
accgacaagttctggggtacatcgggtgtggagagtgtcatcggcagcgtgcacacgtgg
ctggcggaggccatcaacgccctccaggacaacagggacacgctcacggccaaggtcatc
cagggctgcgggaaccccaaggtcaacccccagggccccgggcctgaggagaagcggcgc
cggggcaagctggccccgcgggagaggccaccttcaggcacgctggagaagctggtctcc
gaagccaaggcccagctccgcgacgtccaggacttctggatcagcctcccagggacactg
tgcagtgagaagatggccctgagcactgccagtgatgaccgctgctggaacgggatggcc
agaggccggtacctccccgaggtcatgggtgacggcctggccaaccagatcaacaacccc
gaggtggaggtggacatcaccaagccggacatgaccatccggcagcagatcatgcagctg
aagatcatgaccaaccggctgcgcagcgcctacaacggcaacgacgtggacttccaggac
gccagtgacgacggcagcggctcgggcagcggtgatggctgtctggatgacctctgcagc
cggaaggtcagcaggaagagctccagctcccggacgcccttgacccatgccctcccaggc
ctgtcagagcaggaaggacagaagacctcggctgccagctgcccccagcccccgaccttc
ctcctgcccctcctcctcttcctggcccttacagtagccaggccccggtggcggtaa

DBGET integrated database retrieval system