KEGG   Homo sapiens (human): 28231
Entry
28231             CDS       T01001                                 

Gene name
SLCO4A1, OATP-E, OATP1, OATP4A1, OATPE, OATPRP1, POAT, SLC21A12
Definition
(RefSeq) solute carrier organic anion transporter family member 4A1
  KO
K14354  solute carrier organic anion transporter family, member 4A
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    28231 (SLCO4A1)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC21/ASLCO: Organic anion transporter
   28231 (SLCO4A1)
SSDB
Motif
Pfam: OATP MFS_1 Kazal_2 Kazal_1
Other DBs
NCBI-GeneID: 28231
NCBI-ProteinID: NP_057438
OMIM: 612436
HGNC: 10953
Ensembl: ENSG00000101187
Vega: OTTHUMG00000032923
Pharos: Q96BD0(Tbio)
UniProt: Q96BD0
Position
20q13.33
AA seq 722 aa
MPLHQLGDKPLTFPSPNSAMENGLDHTPPSRRASPGTPLSPGSLRSAAHSPLDTSKQPLC
QLWAEKHGARGTHEVRYVSAGQSVACGWWAFAPPCLQVLNTPKGILFFLCAAAFLQGMTV
NGFINTVITSLERRYDLHSYQSGLIASSYDIAACLCLTFVSYFGGSGHKPRWLGWGVLLM
GTGSLVFALPHFTAGRYEVELDAGVRTCPANPGAVCADSTSGLSRYQLVFMLGQFLHGVG
ATPLYTLGVTYLDENVKSSCSPVYIAIFYTAAILGPAAGYLIGGALLNIYTEMGRRTELT
TESPLWVGAWWVGFLGSGAAAFFTAVPILGYPRQLPGSQRYAVMRAAEMHQLKDSSRGEA
SNPDFGKTIRDLPLSIWLLLKNPTFILLCLAGATEATLITGMSTFSPKFLESQFSLSASE
AATLFGYLVVPAGGGGTFLGGFFVNKLRLRGSAVIKFCLFCTVVSLLGILVFSLHCPSVP
MAGVTASYGGSLLPEGHLNLTAPCNAACSCQPEHYSPVCGSDGLMYFSLCHAGCPAATET
NVDGQKVYRDCSCIPQNLSSGFGHATAGKCTSTCQRKPLLLVFIFVVIFFTFLSSIPALT
ATLRCVRDPQRSFALGIQWIVVRILGGIPGPIAFGWVIDKACLLWQDQCGQQGSCLVYQN
SAMSRYILIMGLLYKVLGVLFFAIACFLYKPLSESSDGLETCLPSQSSAPDSATDSQLQS
SV
NT seq 2169 nt   +upstreamnt  +downstreamnt
atgcccctgcatcagctgggggacaagccgctcaccttccccagccccaactcagccatg
gaaaacgggcttgaccacaccccacccagcaggagggcatccccgggcacacccctgagc
cccggctccctccgctccgctgcccatagccccctggacaccagcaagcagcccctctgc
cagctctgggccgagaagcatggcgcccgggggacccatgaggtgcggtacgtctcggcc
gggcagagcgtggcgtgcggctggtgggccttcgcaccgccgtgcctgcaggtcctcaac
acgcccaagggcatcctgttcttcctgtgtgcggccgcattcctgcaggggatgactgtg
aatggcttcatcaacacagtcatcacctccctggagcgccgctatgacctgcacagctac
cagagcgggctcatcgccagctcctacgacattgccgcctgcctctgcctcaccttcgtc
agctacttcgggggctcagggcacaagccgcgctggctgggctggggcgtgctgcttatg
ggcacggggtcgctggtgttcgcgctgccccacttcacggctggccgctatgaggtggag
ttggacgcgggtgtcaggacgtgccctgccaaccccggcgcggtgtgtgcggacagcacc
tcgggcctgtcccgctaccagctggtcttcatgctgggccagttcctgcatggcgtgggt
gccacacccctctacacgctgggcgtcacctacctggatgagaacgtcaagtccagctgc
tcgcccgtctacattgccatcttctacacagcggccatcctgggcccagctgccggctac
ctgattggaggtgccctgctgaatatctacacggaaatgggccgacggacggagctgacc
accgagagcccactgtgggtcggcgcctggtgggtcggcttcctgggctctggggccgct
gctttcttcaccgccgttcccatccttggttaccctcggcagctgccaggctcccagcgc
tacgcggtcatgagagcggcggaaatgcaccagttgaaggacagcagccgtggggaggcg
agcaacccggactttgggaaaaccatcagagacctgcctctctccatctggctcctgctg
aagaaccccacgttcatcctgctctgcctggccggggccaccgaggccactctcatcacc
ggcatgtccacgttcagccccaagttcttggagtcccagttcagcctgagtgcctcagaa
gctgccaccttgtttgggtacctggtggtgccagcgggtggtggcggcaccttcctgggc
ggcttctttgtgaacaagctcaggctccggggctccgcggtcatcaagttctgcctgttc
tgcaccgttgtcagcctgctgggcatcctcgtcttctcactgcactgccccagtgtgccc
atggcgggcgtcacagccagctacggcgggagcctcctgcccgaaggccacctgaaccta
acggctccctgcaacgctgcctgcagctgccagccagaacactacagccctgtgtgcggc
tcggacggcctcatgtacttctcactgtgccacgcagggtgccctgcagccacggagacg
aatgtggacggccagaaggtgtaccgagactgtagctgtatccctcagaatctttcctct
ggttttggccatgccactgcagggaaatgcacttcaacttgtcagagaaagcccctcctt
ctggttttcatattcgttgtaattttctttacattcctcagcagcattcctgcactaacg
gcaactctacgatgtgtccgtgaccctcagagatcctttgccctgggaatccagtggatt
gtagttagaatactagggggcatcccggggcccatcgccttcggctgggtgatcgacaag
gcctgtctgctgtggcaggaccagtgtggccagcagggctcctgcttggtgtaccagaat
tcggccatgagccgctacatactcatcatggggctcctgtacaaggtgctgggcgtcctc
ttctttgccatagcctgcttcttatacaagcccctgtcggagtcttcagatggcctggaa
acttgtctgcccagccagtcctcagcccctgacagtgccacagatagccagctccagagc
agcgtctga

DBGET integrated database retrieval system