KEGG   Homo sapiens (human): 2826Help
Entry
2826              CDS       T01001                                 

Gene name
CCR10, GPR2
Definition
(RefSeq) C-C motif chemokine receptor 10
  KO
K04185  C-C chemokine receptor type 10
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04062  Chemokine signaling pathway
hsa04672  Intestinal immune network for IgA production
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    2826 (CCR10)
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    2826 (CCR10)
   04062 Chemokine signaling pathway
    2826 (CCR10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    2826 (CCR10)
   04050 Cytokine receptors [BR:hsa04050]
    2826 (CCR10)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Chemokine
   CC Chemokine
    2826 (CCR10)
Cytokine receptors [BR:hsa04050]
 Chemokine receptors
  CC Chemokine
   2826 (CCR10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1
Motif
Other DBs
NCBI-GeneID: 2826
NCBI-ProteinID: NP_057686
OMIM: 600240
HGNC: 4474
Ensembl: ENSG00000184451
Vega: OTTHUMG00000132301
Pharos: P46092(Tbio)
UniProt: P46092
Position
17q21.2
AA seq 362 aa AA seqDB search
MGTEATEQVSWGHYSGDEEDAYSAEPLPELCYKADVQAFSRAFQPSVSLTVAALGLAGNG
LVLATHLAARRAARSPTSAHLLQLALADLLLALTLPFAAAGALQGWSLGSATCRTISGLY
SASFHAGFLFLACISADRYVAIARALPAGPRPSTPGRAHLVSVIVWLLSLLLALPALLFS
QDGQREGQRRCRLIFPEGLTQTVKGASAVAQVALGFALPLGVMVACYALLGRTLLAARGP
ERRRALRVVVALVAAFVVLQLPYSLALLLDTADLLAARERSCPASKRKDVALLVTSGLAL
ARCGLNPVLYAFLGLRFRQDLRRLLRGGSCPSGPQPRRGCPRRPRLSSCSAPTETHSLSW
DN
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atggggacggaggccacagagcaggtttcctggggccattactctggggatgaagaggac
gcatactcggctgagccactgccggagctttgctacaaggccgatgtccaggccttcagc
cgggccttccaacccagtgtctccctgaccgtggctgcgctgggtctggccggcaatggc
ctggtcctggccacccacctggcagcccgacgcgcagcgcgctcgcccacctctgcccac
ctgctccagctggccctggccgacctcttgctggccctgactctgcccttcgcggcagca
ggggctcttcagggctggagtctgggaagtgccacctgccgcaccatctctggcctctac
tcggcctccttccacgccggcttcctcttcctggcctgtatcagcgccgaccgctacgtg
gccatcgcgcgagcgctcccagccgggccgcggccctccactcccggccgcgcacacttg
gtctccgtcatcgtgtggctgctgtcactgctcctggcgctgcctgcgctgctcttcagc
caggatgggcagcgggaaggccaacgacgctgtcgcctcatcttccccgagggcctcacg
cagacggtgaagggggcgagcgccgtggcgcaggtggccctgggcttcgcgctgccgctg
ggcgtcatggtagcctgctacgcgcttctgggccgcacgctgctggccgccagggggccc
gagcgccggcgtgcgctgcgcgtcgtggtggctctggtggcggccttcgtggtgctgcag
ctgccctacagcctcgccctgctgctggatactgccgatctactggctgcgcgcgagcgg
agctgccctgccagcaaacgcaaggatgtcgcactgctggtgaccagcggcttggccctc
gcccgctgtggcctcaatcccgttctctacgccttcctgggcctgcgcttccgccaggac
ctgcggaggctgctacggggtgggagctgcccctcagggcctcaaccccgccgcggctgc
ccccgccggccccgcctttcttcctgctcagctcccacggagacccacagtctctcctgg
gacaactag

DBGET integrated database retrieval system