KEGG   Homo sapiens (human): 282616Help
Entry
282616            CDS       T01001                                 

Gene name
IFNL2, IL-28A, IL28A
Definition
(RefSeq) interferon lambda 2
  KO
K22669  interferon lambda 2/3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04630  Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    282616 (IFNL2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    282616 (IFNL2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    282616 (IFNL2)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Interferons
   282616 (IFNL2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL28A
Motif
Other DBs
NCBI-GeneID: 282616
NCBI-ProteinID: NP_742150
OMIM: 607401
HGNC: 18364
Ensembl: ENSG00000183709
Vega: OTTHUMG00000182806
Pharos: Q8IZJ0(Tbio)
UniProt: Q8IZJ0
Position
19q13.2
AA seq 200 aa AA seqDB search
MKLDMTGDCTPVLVLMAAVLTVTGAVPVARLHGALPDARGCHIAQFKSLSPQELQAFKRA
KDALEESLLLKDCRCHSRLFPRTWDLRQLQVRERPMALEAELALTLKVLEATADTDPALV
DVLDQPLHTLHHILSQFRACIQPQPTAGPRTRGRLHHWLYRLQEAPKKESPGCLEASVTF
NLFRLLTRDLNCVASGDLCV
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgaaactagacatgactggggactgcacgccagtgctggtgctgatggccgcagtgctg
accgtgactggagcagttcctgtcgccaggctccacggggctctcccggatgcaaggggc
tgccacatagcccagttcaagtccctgtctccacaggagctgcaggcctttaagagggcc
aaagatgccttagaagagtcgcttctgctgaaggactgcaggtgccactcccgcctcttc
cccaggacctgggacctgaggcagctgcaggtgagggagcgccccatggctttggaggct
gagctggccctgacgctgaaggttctggaggccaccgctgacactgacccagccctggtg
gacgtcttggaccagccccttcacaccctgcaccatatcctctcccagttccgggcctgt
atccagcctcagcccacggcagggcccaggacccggggccgcctccaccattggctgtac
cggctccaggaggccccaaaaaaggagtcccctggctgcctcgaggcctctgtcaccttc
aacctcttccgcctcctcacgcgagacctgaattgtgttgccagtggggacctgtgtgtc
tga

KEGG   Homo sapiens (human): 282617Help
Entry
282617            CDS       T01001                                 

Gene name
IFNL3, IFN-lambda-3, IFN-lambda-4, IL-28B, IL-28C, IL28B, IL28C
Definition
(RefSeq) interferon lambda 3
  KO
K22669  interferon lambda 2/3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04630  Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    282617 (IFNL3)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    282617 (IFNL3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    282617 (IFNL3)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Interferons
   282617 (IFNL3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL28A
Motif
Other DBs
NCBI-GeneID: 282617
NCBI-ProteinID: NP_742151
OMIM: 607402
HGNC: 18365
Ensembl: ENSG00000197110
Vega: OTTHUMG00000182805
Pharos: Q8IZI9(Tbio)
UniProt: Q8IZI9
Structure
PDB: 

Position
19q13.2
AA seq 196 aa AA seqDB search
MTGDCMPVLVLMAAVLTVTGAVPVARLRGALPDARGCHIAQFKSLSPQELQAFKRAKDAL
EESLLLKDCKCRSRLFPRTWDLRQLQVRERPVALEAELALTLKVLEATADTDPALGDVLD
QPLHTLHHILSQLRACIQPQPTAGPRTRGRLHHWLHRLQEAPKKESPGCLEASVTFNLFR
LLTRDLNCVASGDLCV
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgaccggggactgcatgccagtgctggtgctgatggccgcagtgctgaccgtgactgga
gcagttcctgtcgccaggctccgcggggctctcccggatgcaaggggctgccacatagcc
cagttcaagtccctgtctccacaggagctgcaggcctttaagagggccaaagatgcctta
gaagagtcgcttctgctgaaggactgcaagtgccgctcccgcctcttccccaggacctgg
gacctgaggcagctgcaggtgagggagcgccccgtggctttggaggctgagctggccctg
acgctgaaggttctggaggccaccgctgacactgacccagccctgggggatgtcttggac
cagccccttcacaccctgcaccatatcctctcccagctccgggcctgtatccagcctcag
cccacggcagggcccaggacccggggccgcctccaccattggctgcaccggctccaggag
gccccaaaaaaggagtcccctggctgcctcgaggcctctgtcaccttcaacctcttccgc
ctcctcacgcgagacctgaattgtgttgccagcggggacctgtgtgtctga

DBGET integrated database retrieval system