KEGG   Homo sapiens (human): 282763Help
Entry
282763            CDS       T01001                                 

Gene name
OR51B5, HOR5'Beta5, OR11-37
Definition
(RefSeq) olfactory receptor family 51 subfamily B member 5
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    282763 (OR51B5)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    282763 (OR51B5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx
Motif
Other DBs
NCBI-GeneID: 282763
NCBI-ProteinID: NP_001005567
HGNC: 19599
Ensembl: ENSG00000167355
Vega: OTTHUMG00000066676
Pharos: Q9H339(Tdark)
UniProt: Q9H339 Q05CQ2
Position
11p15.4
AA seq 312 aa AA seqDB search
MSSSGSSHPFLLTGFPGLEEAHHWISVFFLFMYISILFGNGTLLLLIKEDHNLHEPMYFF
LAMLAATDLGLALTTMPTVLGVLWLDHREIGSAACFSQAYFIHSLSFLESGILLAMAYDR
FIAICNPLRYTSVLTNTRVVKIGLGVLMRGFVSVVPPIRPLYFFLYCHSHVLSHAFCLHQ
DVIKLACADTTFNRLYPAVLVVFIFVLDYLIIFISYVLILKTVLSIASREERAKALITCV
SHICCVLVFYVTVIGLSLIHRFGKQVPHIVHLIMSYAYFLFPPLMNPITYSVKTKQIQNA
ILHLFTTHRIGT
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtccagcggcagctcccatcccttcctattgactggttttccaggcttggaggaa
gctcatcactggatttccgtatttttcttgttcatgtatatatccatcctttttggcaat
ggcaccctccttcttctcattaaggaagatcacaatcttcatgagcccatgtacttcttt
ctggccatgctggctgccacagacctggggctggccctgaccacaatgcccacggtgctg
ggagtcctctggctggatcacagggagattggaagtgcggcctgcttttcccaggcctac
tttatacactcactttcctttctcgagtctggcattctgcttgccatggcctatgaccgt
tttattgccatctgcaaccctcttagatatacctctgtacttactaatactcgagtagtg
aagattgggctgggagttctgatgaggggatttgtatccgttgttcccccaatcaggccc
ctctatttttttctgtattgtcactcccatgttctttcacatgcattctgccttcaccag
gatgtcattaaactcgcctgtgctgataccaccttcaaccgactgtacccagctgtgctt
gtagtctttatatttgtgctggattatctgattatcttcatctcctatgtgttgatactc
aagactgtcctgagcattgcctccagagaggagagggccaaggctctcattacctgtgtc
tcccatatctgctgtgtcctggttttttatgtcacagtgattggattgtctctgattcat
cgttttggaaagcaggttccacatattgttcacctcattatgagctatgcctattttctg
ttccctccactaatgaatcctataacatatagtgtcaagaccaagcagattcagaatgcc
attcttcacctttttactacccatagaattggaacctga

DBGET integrated database retrieval system