KEGG   Homo sapiens (human): 2828
Entry
2828              CDS       T01001                                 

Gene name
GPR4, GPR6C.l
Definition
(RefSeq) G protein-coupled receptor 4
  KO
K04312  G protein-coupled receptor 4
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    2828 (GPR4)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Others
   Proton-sensing GPCRs
    2828 (GPR4)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srx 7tm_4 7TM_GPCR_Srv 7TM_GPCR_Srsx PgaD T4SS_pilin DUF3429
Other DBs
NCBI-GeneID: 2828
NCBI-ProteinID: NP_005273
OMIM: 600551
HGNC: 4497
Ensembl: ENSG00000177464
Vega: OTTHUMG00000182126
Pharos: P46093(Tbio)
UniProt: P46093
Position
19q13.32
AA seq 362 aa
MGNHTWEGCHVDSRVDHLFPPSLYIFVIGVGLPTNCLALWAAYRQVQQRNELGVYLMNLS
IADLLYICTLPLWVDYFLHHDNWIHGPGSCKLFGFIFYTNIYISIAFLCCISVDRYLAVA
HPLRFARLRRVKTAVAVSSVVWATELGANSAPLFHDELFRDRYNHTFCFEKFPMEGWVAW
MNLYRVFVGFLFPWALMLLSYRGILRAVRGSVSTERQEKAKIKRLALSLIAIVLVCFAPY
HVLLLSRSAIYLGRPWDCGFEERVFSAYHSSLAFTSLNCVADPILYCLVNEGARSDVAKA
LHNLLRFLASDKPQEMANASLTLETPLTSKRNSTAKAMTGSWAATPPSQGDQVQLKMLPP
AQ
NT seq 1089 nt   +upstreamnt  +downstreamnt
atgggcaaccacacgtgggagggctgccacgtggactcgcgcgtggaccacctctttccg
ccatccctctacatctttgtcatcggcgtggggctgcccaccaactgcctggctctgtgg
gcggcctaccgccaggtgcaacagcgcaacgagctgggcgtctacctgatgaacctcagc
atcgccgacctgctgtacatctgcacgctgccgctgtgggtggactacttcctgcaccac
gacaactggatccacggccccgggtcctgcaagctctttgggttcatcttctacaccaat
atctacatcagcatcgccttcctgtgctgcatctcggtggaccgctacctggctgtggcc
cacccactccgcttcgcccgcctgcgccgcgtcaagaccgccgtggccgtgagctccgtg
gtctgggccacggagctgggcgccaactcggcgcccctgttccatgacgagctcttccga
gaccgctacaaccacaccttctgctttgagaagttccccatggaaggctgggtggcctgg
atgaacctctatcgggtgttcgtgggcttcctcttcccgtgggcgctcatgctgctgtcg
taccggggcatcctgcgggccgtgcggggcagcgtgtccaccgagcgccaggagaaggcc
aagatcaagcggctggccctcagcctcatcgccatcgtgctggtctgctttgcgccctat
cacgtgctcttgctgtcccgcagcgccatctacctgggccgcccctgggactgcggcttc
gaggagcgcgtcttttctgcataccacagctcactggctttcaccagcctcaactgtgtg
gcggaccccatcctctactgcctggtcaacgagggcgcccgcagcgatgtggccaaggcc
ctgcacaacctgctccgctttctggccagcgacaagccccaggagatggccaatgcctcg
ctcaccctggagaccccactcacctccaagaggaacagcacagccaaagccatgactggc
agctgggcggccactccgccctcccagggggaccaggtgcagctgaagatgctgccgcca
gcacaatga

DBGET integrated database retrieval system