KEGG   Homo sapiens (human): 282890Help
Entry
282890            CDS       T01001                                 

Gene name
ZNF311, zf31
Definition
(RefSeq) zinc finger protein 311
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    282890 (ZNF311)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    282890 (ZNF311)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Other Cys2His2 zinc factors
    282890 (ZNF311)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 KRAB zf-C2H2_6 zf-C2H2_jaz Zn-ribbon_8 zf-C2H2_11 DZR zinc_ribbon_15 DUF3268 FYVE
Motif
Other DBs
NCBI-GeneID: 282890
NCBI-ProteinID: NP_001010877
HGNC: 13847
Ensembl: ENSG00000197935
Vega: OTTHUMG00000031292
Pharos: Q5JNZ3(Tdark)
UniProt: Q5JNZ3 A0A1U9X8W3
Position
6p22.1
AA seq 666 aa AA seqDB search
MQEVVLLDESSGPPSQLLWTRQDTQLPQESALLPAPYPAFTKDGSQGNLPQADITLMSQA
QESVTFEDVAVNFTNREWQCLTYAQRHLYKDVMLENYGNMVSLGFPFPKPPLISHLEREV
DPCVQDPQDRESLSCSYPVSADKMWPENEKASSQQEIFENGEAYWMKFNSLLKVDSRDPK
VREVCVQDVKLENQWETSIREKLREEKEGSEEVTCKKGKNQKVLSKNLNPNSKHSQCNKV
LIAQKLHECARCGKNFSWHSDLILHEQIHSGEKPHVCNECGKAFKTRNQLSMHRIIHTGE
KPFNCTQCGKAFNSRSALCRHKKTHSGEKPHECRDCGKAFKTRNRLCMHQLIHTGEKPYK
CNCCGKAFQFKHSLTIHGRIHTGEKPYECEECGKAFSGSSDLTKHIRIHTGERPYECSKC
GRAFSRSSDLSKHKRIHTREKHYGCPQCGKDFSIKAELTKHRRIHTEEKRYRCEECGKAF
RHNCKRRAHEREHTGEKPYQCRDCGKTFQDKHCLTIHQRIHTGEKPYKCLECGKAFSGKS
NLTNHRRIHTGEKPHKCEVCGMAFHHSSVLRQHKRIHTGEKPYTCSECGTSFRQGSALIG
HKRVHTGEKPYECEECGKAFRVSSNLTGHKKRKHQVWSTHELDGSRKSLSPVTVSQTSVV
SILTSA
NT seq 2001 nt NT seq  +upstreamnt  +downstreamnt
atgcaggaggttgtgctgttggatgagagttcaggaccaccaagccagctgctttggacc
cgccaggatacccagctccctcaggaaagcgctctattacctgctccatatcctgccttc
actaaagatggaagccaaggaaacctgccgcaagcagatatcacactaatgagccaggcc
caagagtcagtgacatttgaggatgtagctgtgaacttcactaacagggagtggcagtgt
ctgacctacgctcaaaggcatctctataaggatgtgatgttggaaaattatgggaacatg
gtatcacttggatttccatttcctaaacctcctttaatctctcatctggagcgagaagta
gacccctgtgtgcaggatccacaggacagggagtccctaagctgctcctacccagtgtca
gctgacaagatgtggcctgagaatgaaaaggcaagttcacaacaagagatttttgaaaat
ggagaagcctactggatgaaatttaacagtctcctaaaagttgattcccgggatcctaag
gttagagaagtttgtgttcaggatgtcaaattagagaatcaatgggaaacatctataagg
gagaaactgagagaagagaaagaaggctctgaggaagtgacctgcaaaaaaggaaagaac
cagaaagtgcttagtaaaaacttgaatccaaactcaaaacatagtcaatgtaataaagtt
cttatagcacagaaactccatgaatgtgccaggtgtggcaaaaacttcagttggcactca
gatctaattctccatgagcaaattcattctggtgagaaaccccatgtgtgtaatgagtgt
gggaaagcattcaagaccagaaatcagctttctatgcaccggataatccacacaggggag
aaaccttttaattgcacccagtgtgggaaggctttcaacagtagatcagctctttgccga
cataaaaaaacccacagtggggagaagcctcacgagtgcagggactgtgggaaggccttc
aagaccaggaaccgtctctgtatgcatcagcttatccacaccggggagaagccttacaaa
tgtaactgctgtgggaaggccttccagtttaagcattcccttaccatccatggcagaatc
cacactggggagaagccatatgaatgtgaggagtgcgggaaggccttcagtgggagttca
gacctcaccaaacacataagaatccacactggggaacgaccttatgagtgcagcaagtgt
ggaagggccttcagtcggagctcagacctaagcaaacacaaacgaatccatactcgggag
aaacactatgggtgtccccagtgtggaaaagacttcagcatcaaggcagaactcaccaaa
cacagaaggatccacactgaagagaaacgttacaggtgtgaggagtgtgggaaagccttt
cgtcataactgtaagcgcagggctcatgaacgagagcatacaggggagaagccctatcaa
tgcagggattgtgggaaaaccttccaagataagcactgccttaccatccatcagagaatc
cacactggagagaaaccttacaaatgtttagagtgtgggaaagctttcagtgggaagtca
aacttgaccaatcatcgaagaattcacactggagagaagcctcacaaatgtgaggtatgt
ggaatggccttccatcatagttcagtcctgaggcagcacaaaagaatccacactggtgag
aagccatacacctgcagtgagtgtggcacgtccttccgtcagggctcagctctgattgga
cataagcgagttcatactggggagaaaccttatgaatgtgaggaatgtggaaaagctttt
agagtgagctcaaatcttactggacataagaaaagaaaacatcaagtatggagtacccat
gaacttgatgggagtaggaaatccctctctccagtgactgtttctcagacctcagtagtc
agtattttgaccagtgcctga

DBGET integrated database retrieval system