KEGG   Homo sapiens (human): 282974Help
Entry
282974            CDS       T01001                                 

Gene name
STK32C, PKE, YANK3
Definition
(RefSeq) serine/threonine kinase 32C
  KO
K08793  serine/threonine kinase 32 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    282974 (STK32C)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     282974 (STK32C)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: AGC group
  YANK family
   282974 (STK32C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Pkinase_fungal APH Kdo
Motif
Other DBs
NCBI-GeneID: 282974
NCBI-ProteinID: NP_775846
HGNC: 21332
Ensembl: ENSG00000165752
Vega: OTTHUMG00000019285
Pharos: Q86UX6(Tbio)
UniProt: Q86UX6 A0A140VJW0 B7Z7J1
Position
10q26.3
AA seq 486 aa AA seqDB search
MRSGAERRGSSAAASPGSPPPGRARPAGSDAPSALPPPAAGQPRARDSGDVRSQPRPLFQ
WSKWKKRMGSSMSAATARRPVFDDKEDVNFDHFQILRAIGKGSFGKVCIVQKRDTEKMYA
MKYMNKQQCIERDEVRNVFRELEILQEIEHVFLVNLWYSFQDEEDMFMVVDLLLGGDLRY
HLQQNVQFSEDTVRLYICEMALALDYLRGQHIIHRDVKPDNILLDERGHAHLTDFNIATI
IKDGERATALAGTKPYMAPEIFHSFVNGGTGYSFEVDWWSVGVMAYELLRGWRPYDIHSS
NAVESLVQLFSTVSVQYVPTWSKEMVALLRKLLTVNPEHRLSSLQDVQAAPALAGVLWDH
LSEKRVEPGFVPNKGRLHCDPTFELEEMILESRPLHKKKKRLAKNKSRDNSRDSSQSEND
YLQDCLDAIQQDFVIFNREKLKRSQDLPREPLPAPESRDAAEPVEDEAERSALPMCGPIC
PSAGSG
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgaggagtggcgccgagcgcaggggcagcagcgccgcggcgtccccgggctcgccgccc
cccggccgcgcgcgccccgccggctccgacgcgccctcggccctgccgccgcccgctgct
ggccagccccgggcccgggactcgggcgatgtccgctcgcagccgcgccccctgtttcag
tggagcaagtggaagaagaggatgggctcgtccatgtcggcggccaccgcgcggaggccg
gtgtttgacgacaaggaggacgtgaacttcgaccacttccagatccttcgggccattggg
aagggcagctttggcaaggtgtgcattgtgcagaagcgggacacggagaagatgtacgcc
atgaagtacatgaacaagcagcagtgcatcgagcgcgacgaggtccgcaacgtcttccgg
gagctggagatcctgcaggagatcgagcacgtcttcctggtgaacctctggtactccttc
caggacgaggaggacatgttcatggtcgtggacctgctactgggcggggacctgcgctac
cacctgcagcagaacgtgcagttctccgaggacacggtgaggctgtacatctgcgagatg
gcactggctctggactacctgcgcggccagcacatcatccacagagatgtcaagcctgac
aacattctcctggatgagagaggacatgcacacctgaccgacttcaacattgccaccatc
atcaaggacggggagcgggcgacggcattagcaggcaccaagccgtacatggctccggag
atcttccactcttttgtcaacggcgggaccggctactccttcgaggtggactggtggtcg
gtgggggtgatggcctatgagctgctgcgaggatggaggccctatgacatccactccagc
aacgccgtggagtccctggtgcagctgttcagcaccgtgagcgtccagtatgtccccacg
tggtccaaggagatggtggccttgctgcggaagctcctcactgtgaaccccgagcaccgg
ctctccagcctccaggacgtgcaggcagccccggcgctggccggcgtgctgtgggaccac
ctgagcgagaagagggtggagccgggcttcgtgcccaacaaaggccgtctgcactgcgac
cccacctttgagctggaggagatgatcctggagtccaggcccctgcacaagaagaagaag
cgtctggccaagaacaagtcccgggacaacagcagggacagctcccagtccgagaatgac
tatcttcaagactgcctcgatgccatccagcaagacttcgtgatttttaacagagaaaag
ctgaagaggagccaggacctcccgagggagcctctccccgcccctgagtccagggatgct
gcggagcctgtggaggacgaggcggaacgctccgccctgcccatgtgcggccccatttgc
ccctcggccgggagcggctag

DBGET integrated database retrieval system