KEGG   Homo sapiens (human): 282974
Entry
282974            CDS       T01001                                 
Symbol
STK32C, PKE, YANK3
Name
(RefSeq) serine/threonine kinase 32C
  KO
K08793  serine/threonine kinase 32 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    282974 (STK32C)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     282974 (STK32C)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: AGC group
  YANK family
   282974 (STK32C)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Pkinase_fungal APH Kdo
Other DBs
NCBI-GeneID: 282974
NCBI-ProteinID: NP_775846
HGNC: 21332
Ensembl: ENSG00000165752
Pharos: Q86UX6(Tbio)
UniProt: Q86UX6 A0A140VJW0 B7Z7J1
Position
10:complement(132207482..132332235)
AA seq 486 aa
MRSGAERRGSSAAASPGSPPPGRARPAGSDAPSALPPPAAGQPRARDSGDVRSQPRPLFQ
WSKWKKRMGSSMSAATARRPVFDDKEDVNFDHFQILRAIGKGSFGKVCIVQKRDTEKMYA
MKYMNKQQCIERDEVRNVFRELEILQEIEHVFLVNLWYSFQDEEDMFMVVDLLLGGDLRY
HLQQNVQFSEDTVRLYICEMALALDYLRGQHIIHRDVKPDNILLDERGHAHLTDFNIATI
IKDGERATALAGTKPYMAPEIFHSFVNGGTGYSFEVDWWSVGVMAYELLRGWRPYDIHSS
NAVESLVQLFSTVSVQYVPTWSKEMVALLRKLLTVNPEHRLSSLQDVQAAPALAGVLWDH
LSEKRVEPGFVPNKGRLHCDPTFELEEMILESRPLHKKKKRLAKNKSRDNSRDSSQSEND
YLQDCLDAIQQDFVIFNREKLKRSQDLPREPLPAPESRDAAEPVEDEAERSALPMCGPIC
PSAGSG
NT seq 1461 nt   +upstreamnt  +downstreamnt
atgaggagtggcgccgagcgcaggggcagcagcgccgcggcgtccccgggctcgccgccc
cccggccgcgcgcgccccgccggctccgacgcgccctcggccctgccgccgcccgctgct
ggccagccccgggcccgggactcgggcgatgtccgctcgcagccgcgccccctgtttcag
tggagcaagtggaagaagaggatgggctcgtccatgtcggcggccaccgcgcggaggccg
gtgtttgacgacaaggaggacgtgaacttcgaccacttccagatccttcgggccattggg
aagggcagctttggcaaggtgtgcattgtgcagaagcgggacacggagaagatgtacgcc
atgaagtacatgaacaagcagcagtgcatcgagcgcgacgaggtccgcaacgtcttccgg
gagctggagatcctgcaggagatcgagcacgtcttcctggtgaacctctggtactccttc
caggacgaggaggacatgttcatggtcgtggacctgctactgggcggggacctgcgctac
cacctgcagcagaacgtgcagttctccgaggacacggtgaggctgtacatctgcgagatg
gcactggctctggactacctgcgcggccagcacatcatccacagagatgtcaagcctgac
aacattctcctggatgagagaggacatgcacacctgaccgacttcaacattgccaccatc
atcaaggacggggagcgggcgacggcattagcaggcaccaagccgtacatggctccggag
atcttccactcttttgtcaacggcgggaccggctactccttcgaggtggactggtggtcg
gtgggggtgatggcctatgagctgctgcgaggatggaggccctatgacatccactccagc
aacgccgtggagtccctggtgcagctgttcagcaccgtgagcgtccagtatgtccccacg
tggtccaaggagatggtggccttgctgcggaagctcctcactgtgaaccccgagcaccgg
ctctccagcctccaggacgtgcaggcagccccggcgctggccggcgtgctgtgggaccac
ctgagcgagaagagggtggagccgggcttcgtgcccaacaaaggccgtctgcactgcgac
cccacctttgagctggaggagatgatcctggagtccaggcccctgcacaagaagaagaag
cgtctggccaagaacaagtcccgggacaacagcagggacagctcccagtccgagaatgac
tatcttcaagactgcctcgatgccatccagcaagacttcgtgatttttaacagagaaaag
ctgaagaggagccaggacctcccgagggagcctctccccgcccctgagtccagggatgct
gcggagcctgtggaggacgaggcggaacgctccgccctgcccatgtgcggccccatttgc
ccctcggccgggagcggctag

DBGET integrated database retrieval system