KEGG   Homo sapiens (human): 283092Help
Entry
283092            CDS       T01001                                 

Gene name
OR4C13
Definition
(RefSeq) olfactory receptor family 4 subfamily C member 13
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    283092 (OR4C13)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    283092 (OR4C13)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 DUF872
Motif
Other DBs
NCBI-GeneID: 283092
NCBI-ProteinID: NP_001001955
HGNC: 15169
Ensembl: ENSG00000258817
Vega: OTTHUMG00000166686
Pharos: Q8NGP0(Tdark)
UniProt: Q8NGP0
Position
11p11.12
AA seq 309 aa AA seqDB search
MANRNNVTEFILLGLTENPKMQKIIFVVFSVIYINAMIGNVLIVVTITASPSLRSPMYFF
LAYLSFIDACYSSVNTPKLITDSLYENKTILFNGCMTQVFGEHFFRGVEVILLTVMAYDH
YVAICKPLHYTTVMKQHVCSLLVGVSWVGGFLHATIQILFICQLPFCGPNVIDHFMCDLY
TLINLACTNTHTLGLFIAANSGFICLLNCLLLLVSCVVILYSLKTHSLEARHEALSTCVS
HITVVILSFIPCIFVYMRPPATLPIDKAVAVFYTMITSMLNPLIYTLRNAQMKNAIRKLC
SRKAISSVK
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atggcgaatagaaacaatgtgacagagtttattctattggggcttacagagaatccaaaa
atgcagaaaatcatatttgttgtgttttctgtcatctacatcaacgccatgataggaaat
gtgctcattgtggtcaccatcactgccagcccatcactgagatcccccatgtactttttc
ctggcctatctctcctttattgatgcctgctattcctctgtcaatacccctaagctgatc
acagattcactctatgaaaacaagactatcttattcaatggatgtatgactcaagtcttt
ggagaacattttttcagaggtgttgaggtcatcctacttactgtaatggcctatgaccac
tatgtggccatctgcaagcccttgcactataccaccgtcatgaagcagcatgtttgtagc
ctgctagtgggagtgtcatgggtaggaggctttcttcatgcaaccatacagatcctcttc
atctgtcaattacctttctgtggtcctaatgtcatagatcactttatgtgtgatctctac
actttgatcaatcttgcctgcactaatacccacactctaggactcttcattgctgccaac
agtgggttcatatgcctgttaaactgtctcttgctcctggtctcctgcgtggtcatactg
tactccttaaagacccacagcttagaggcaaggcacgaagccctctctacctgtgtctcc
cacatcacagttgtcatcttatcctttataccctgcatatttgtgtacatgagacctcca
gctactttacccattgataaagcagttgctgtattctacactatgataacttctatgtta
aaccccttaatctacaccttgaggaatgctcaaatgaaaaatgccattaggaaattgtgt
agtaggaaagctatttcaagtgtcaaataa

DBGET integrated database retrieval system