KEGG   Homo sapiens (human): 283130
Entry
283130            CDS       T01001                                 

Gene name
SLC25A45
Definition
(RefSeq) solute carrier family 25 member 45
  KO
K15123  solute carrier family 25, member 45/47
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    283130 (SLC25A45)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC25: Mitochondrial carrier
   283130 (SLC25A45)
SSDB
Motif
Pfam: Mito_carr
Other DBs
NCBI-GeneID: 283130
NCBI-ProteinID: NP_872362
OMIM: 610825
HGNC: 27442
Ensembl: ENSG00000162241
Vega: OTTHUMG00000166255
Pharos: Q8N413(Tdark)
UniProt: Q8N413
Position
11q13.1
AA seq 288 aa
MPVEEFVAGWISGALGLVLGHPFDTVKVRLQTQTTYRGIVDCMVKIYRHESLLGFFKGMS
FPIASIAVVNSVLFGVYSNTLLVLTATSHQERRAQPPSYMHIFLAGCTGGFLQAYCLAPF
DLIKVRLQNQTEPRAQPGSPPPRYQGPVHCAASIFREEGPRGLFRGAWALTLRDTPTVGI
YFITYEGLCRQYTPEGQNPSSATVLVAGGFAGIASWVAATPLDMIKSRMQMDGLRRRVYQ
GMLDCMVSSIRQEGLGVFFRGVTINSARAFPVNAVTFLSYEYLLRWWG
NT seq 867 nt   +upstreamnt  +downstreamnt
atgccggtggaggaatttgtggctggctggatctctggcgctctgggcttggtcctggga
cacccgtttgacactgtaaaggtgaggctgcagacccagaccacctaccggggcatcgtt
gattgcatggtcaagatttaccgccatgagtccctcctgggcttcttcaagggaatgagc
ttccccattgccagcatagctgtggtcaactctgtcctgtttggggtctatagcaacacc
ctgctggtgctcacggccacctcccaccaggagcggcgggcccagccgcccagctacatg
cacatcttcctagcgggctgcaccggggggttcctgcaggcctactgtctggctcctttt
gacctcatcaaagtccggctacaaaaccagacagagccaagggcccagccagggagcccc
ccaccccggtaccaggggcccgtgcactgtgcagcctccatcttccgggaggaggggccc
cgggggctgttccgaggagcctgggccctgacgctgagggacacccccacggtggggatc
tacttcatcacctatgaagggctctgtcgccagtacacaccagaaggccagaatcccagc
tcagccacggtgctggtggcagggggctttgcaggcattgcttcctgggtggcagccacg
cccttagacatgatcaagtcccggatgcagatggatggactgagacgcagagtgtaccag
gggatgctggactgcatggtgagcagcatccggcaggaaggactgggagtcttcttccgg
ggggtcaccatcaacagtgcccgcgcctttcccgtcaatgctgtcaccttcctcagctac
gaatatctcctccgctggtggggatga

DBGET integrated database retrieval system