KEGG   Homo sapiens (human): 283159Help
Entry
283159            CDS       T01001                                 

Gene name
OR8D1, JCG9, OR8D3, OST004, PDJ9J14
Definition
(RefSeq) olfactory receptor family 8 subfamily D member 1
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    283159 (OR8D1)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    283159 (OR8D1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx
Motif
Other DBs
NCBI-GeneID: 283159
NCBI-ProteinID: NP_001002917
HGNC: 8481
Ensembl: ENSG00000196341
Vega: OTTHUMG00000165977
Pharos: Q8WZ84(Tdark)
UniProt: Q8WZ84 A0A126GVG6
Position
11q24.2
AA seq 308 aa AA seqDB search
MTMENYSMAAQFVLDGLTQQAELQLPLFLLFLGIYVVTVVGNLGMILLIAVSPLLHTPMY
YFLSSLSFVDFCYSSVITPKMLVNFLGKKNTILYSECMVQLFFFVVFVVAEGYLLTAMAY
DRYVAICSPLLYNAIMSSWVCSLLVLAAFFLGFLSALTHTSAMMKLSFCKSHIINHYFCD
VLPLLNLSCSNTHLNELLLFIIAGFNTLVPTLAVAVSYAFILYSILHIRSSEGRSKAFGT
CSSHLMAVVIFFGSITFMYFKPPSSNSLDQEKVSSVFYTTVIPMLNPLIYSLRNKDVKKA
LRKVLVGK
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgaccatggaaaattattctatggcagctcagtttgtcttagatggtttaacacagcaa
gcagagctccagctgcccctcttcctcctgttcctgggaatctatgtggtcacagtagtg
ggcaacctgggcatgattctcctgattgcagtcagccctctacttcacacccccatgtac
tatttcctcagcagcttgtccttcgtcgatttctgctattcctctgtcattactcccaaa
atgctggtgaacttcctaggaaagaagaatacaatcctttactctgagtgcatggtccag
ctctttttctttgtggtctttgtggtggctgagggttacctcctgactgccatggcatat
gatcgctatgttgccatctgtagcccactgctttataatgcgatcatgtcctcatgggtc
tgctcactgctagtgctggctgccttcttcttgggctttctctctgccttgactcataca
agtgccatgatgaaactgtccttttgcaaatcccacattatcaaccattacttctgtgat
gttcttcccctcctcaatctctcctgctccaacacacacctcaatgagcttctacttttt
atcattgcggggtttaacaccttggtgcccaccctagctgttgctgtctcctatgccttc
atcctctacagcatccttcacatccgctcctcagagggccggtccaaagcttttggaaca
tgcagctctcatctcatggctgtggtgatcttctttgggtccattaccttcatgtatttc
aagcccccttcaagtaactccctggaccaggagaaggtgtcctctgtgttctacaccacg
gtgatccccatgctgaaccctttaatatacagtctgaggaataaggatgtgaagaaagca
ttaaggaaggtcttagtaggaaaatga

DBGET integrated database retrieval system