KEGG   Homo sapiens (human): 283160
Entry
283160            CDS       T01001                                 

Gene name
OR8D2, JCG2
Definition
(RefSeq) olfactory receptor family 8 subfamily D member 2
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    283160 (OR8D2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    283160 (OR8D2)
G protein-coupled receptors [BR:hsa04030]
 Others
  Chemoreception
   Olfactory
    283160 (OR8D2)
SSDB
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx
Other DBs
NCBI-GeneID: 283160
NCBI-ProteinID: NP_001002918
HGNC: 8482
Ensembl: ENSG00000279116
Vega: OTTHUMG00000165978
Pharos: Q9GZM6(Tdark)
UniProt: Q9GZM6 A0A126GVG3
Position
11q24.2
AA seq 311 aa
MATSNHSSGAEFILAGLTQRPELQLPLFLLFLGIYVVTVVGNLGMIFLIALSSQLYPPVY
YFLSHLSFIDLCYSSVITPKMLVNFVPEENIISFLECITQLYFFLIFVIAEGYLLTAMEY
DRYVAICRPLLYNIVMSHRVCSIMMAVVYSLGFLWATVHTTRMSVLSFCRSHTVSHYFCD
ILPLLTLSCSSTHINEILLFIIGGVNTLATTLAVLISYAFIFSSILGIHSTEGQSKAFGT
CSSHLLAVGIFFGSITFMYFKPPSSTTMEKEKVSSVFYITIIPMLNPLIYSLRNKDVKNA
LKKMTRGRQSS
NT seq 936 nt   +upstreamnt  +downstreamnt
atggctacttcaaaccattcttcaggggctgagtttatcctggcaggcttgacacaacgc
ccagaacttcaactgccactcttcctcctgttccttggaatatatgtggtcacagtggtg
gggaacctgggcatgatcttcttaattgctctcagttctcaactttaccctccagtgtat
tattttctcagtcatttgtctttcattgatctctgctactcctctgtcattacccctaag
atgctggtgaactttgttccagaggagaacattatctcctttctggaatgcattactcaa
ctttatttcttccttatttttgtaattgcagaaggctaccttctgacagccatggaatat
gaccgttatgttgctatctgtcgcccactgctttacaatattgtcatgtcccacagggtc
tgttccataatgatggctgtggtatactcactgggttttctgtgggccacagtccatact
acccgcatgtcagtgttgtcattctgtaggtctcatacggtcagtcattatttttgtgat
attctccccttattgactctgtcttgctccagcacccacatcaatgagattctgctgttc
attattggaggagttaataccttagcaactacactggcggtccttatctcttatgctttc
attttctctagtatccttggtattcattccactgaggggcaatccaaagcctttggcact
tgtagctcccatctcttggctgtgggcatcttttttgggtctataacattcatgtatttc
aagcccccttccagcactactatggaaaaagagaaggtgtcttctgtgttctacatcaca
ataatccccatgctgaatcctctaatctatagcctgaggaacaaggatgtgaaaaatgca
ctgaagaagatgactaggggaaggcagtcatcctga

DBGET integrated database retrieval system