KEGG   Homo sapiens (human): 283162
Entry
283162            CDS       T01001                                 

Gene name
OR8B4, OR11-315, OR8B4P
Definition
(RefSeq) olfactory receptor family 8 subfamily B member 4
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    283162 (OR8B4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    283162 (OR8B4)
G protein-coupled receptors [BR:hsa04030]
 Others
  Chemoreception
   Olfactory
    283162 (OR8B4)
SSDB
Motif
Pfam: 7tm_4 7tm_1 DUF5362
Other DBs
NCBI-GeneID: 283162
NCBI-ProteinID: NP_001005196
HGNC: 8473
Ensembl: ENSG00000280090
Vega: OTTHUMG00000165916
Pharos: Q96RC9(Tdark)
UniProt: Q96RC9
Position
11q24.2
AA seq 309 aa
MTLRNSSSVTEFILVGLSEQPELQLPLFLLFLGIYVFTVVGNLGLITLIGINPSLHTPMY
FFLFNLSFIDLCYSCVFTPKMLNDFVSESIISYVGCMTQLFFFCFFVNSECYVLVSMAYD
RYVAICNPLLYMVTMSPRVCFLLMFGSYVVGFAGAMAHTGSMLRLTFCDSNVIDHYLCDV
LPLLQLSCTSTHVSELVFFIVVGVITMLSSISIVISYALILSNILCIPSAEGRSKAFSTW
GSHIIAVALFFGSGTFTYLTTSFPGSMNHGRFASVFYTNVVPMLNPSIYSLRNKDDKLAL
GKTLKRVLF
NT seq 930 nt   +upstreamnt  +downstreamnt
atgactctgagaaacagctcctcagtgactgagtttatccttgtgggattatcagaacag
ccagagctccagctccctcttttccttctattcttagggatctatgtgttcactgtggtg
ggcaacttgggcttgatcaccttaattgggataaatcctagccttcacacccccatgtac
tttttcctcttcaacttgtcctttatagatctctgttattcctgtgtgtttacccccaaa
atgctgaatgactttgtttcagaaagtatcatctcttatgtgggatgtatgactcagcta
tttttcttctgtttctttgtcaattctgagtgctatgtgttggtatcaatggcctatgat
cgctatgtggccatctgcaaccccctgctctacatggtcaccatgtccccaagggtctgc
tttctgctgatgtttggttcctatgtggtagggtttgctggggccatggcccacactgga
agcatgctgcgactgaccttctgtgattccaacgtcattgaccattatctgtgtgacgtt
ctccccctcttgcagctctcctgcaccagcacccatgtcagtgagctggtatttttcatt
gttgttggagtaatcaccatgctatccagcataagcatcgtcatctcttacgctttgata
ctctccaacatcctctgtattccttctgcagagggcagatccaaagcctttagcacatgg
ggctcccacataattgctgttgctctgttttttgggtcagggacattcacctacttaaca
acatcttttcctggctctatgaaccatggcagatttgcctcagtcttttacaccaatgtg
gttcccatgcttaacccttcgatctacagtttgaggaataaggatgataaacttgccctg
ggcaaaaccctgaagagagtgctcttctaa

DBGET integrated database retrieval system