KEGG   Homo sapiens (human): 283208
Entry
283208            CDS       T01001                                 

Gene name
P4HA3
Definition
(RefSeq) prolyl 4-hydroxylase subunit alpha 3
  KO
K00472  prolyl 4-hydroxylase [EC:1.14.11.2]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00330  Arginine and proline metabolism
hsa01100  Metabolic pathways
Drug target
Lufironil: D04793
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    283208 (P4HA3)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.2  procollagen-proline 4-dioxygenase
     283208 (P4HA3)
SSDB
Motif
Pfam: P4Ha_N 2OG-FeII_Oxy_3 TPR_2 HrpB1_HrpK TPR_8 SPO22 DUF1518 TPR_12
Other DBs
NCBI-GeneID: 283208
NCBI-ProteinID: NP_878907
OMIM: 608987
HGNC: 30135
Ensembl: ENSG00000149380
Vega: OTTHUMG00000165254
Pharos: Q7Z4N8(Tdark)
UniProt: Q7Z4N8
Position
11q13.4
AA seq 544 aa
MGPGARLAALLAVLALGTGDPERAAARGDTFSALTSVARALAPERRLLGLLRRYLRGEEA
RLRDLTRFYDKVLSLHEDSTTPVANPLLAFTLIKRLQSDWRNVVHSLEASENIRALKDGY
EKVEQDLPAFEDLEGAARALMRLQDVYMLNVKGLARGVFQRVTGSAITDLYSPKRLFSLT
GDDCFQVGKVAYDMGDYYHAIPWLEEAVSLFRGSYGEWKTEDEASLEDALDHLAFAYFRA
GNVSCALSLSREFLLYSPDNKRMARNVLKYERLLAESPNHVVAEAVIQRPNIPHLQTRDT
YEGLCQTLGSQPTLYQIPSLYCSYETNSNAYLLLQPIRKEVIHLEPYIALYHDFVSDSEA
QKIRELAEPWLQRSVVASGEKQLQVEYRISKSAWLKDTVDPKLVTLNHRIAALTGLDVRP
PYAEYLQVVNYGIGGHYEPHFDHATSPSSPLYRMKSGNRVATFMIYLSSVEAGGATAFIY
ANLSVPVVRNAALFWWNLHRSGEGDSDTLHAGCPVLVGDKWVANKWIHEYGQEFRRPCSS
SPED
NT seq 1635 nt   +upstreamnt  +downstreamnt
atgggtcctggggcgcggctggcggcgctgctggcggtgctggcgctcgggacaggagac
ccagaaagggctgcggctcggggcgacacgttctcggcgctgaccagcgtggcgcgcgcc
ctggcgcccgagcgccggctgctggggctgctgaggcggtacctgcgcggggaggaggcg
cggctgcgggacctgactagattctacgacaaggtactttctttgcatgaggattcaaca
acccctgtggctaaccctctgcttgcatttactctcatcaaacgcctgcagtctgactgg
aggaatgtggtacatagtctggaggccagtgagaacatccgagctctgaaggatggctat
gagaaggtggagcaagaccttccagcctttgaggaccttgagggagcagcaagggccctg
atgcggctgcaggacgtgtacatgctcaatgtgaaaggcctggcccgaggtgtctttcag
agagtcactggctctgccatcactgacctgtacagccccaaacggctcttttctctcaca
ggggatgactgcttccaagttggcaaggtggcctatgacatgggggattattaccatgcc
attccatggctggaggaggctgtcagtctcttccgaggatcttacggagagtggaagaca
gaggatgaggcaagtctagaagatgccttggatcacttggcctttgcttatttccgggca
ggaaatgtttcgtgtgccctcagcctctctcgggagtttcttctctacagcccagataat
aagaggatggccaggaatgtcttgaaatatgaaaggctcttggcagagagccccaaccac
gtggtagctgaggctgtcatccagaggcccaatataccccacctgcagaccagagacacc
tacgaggggctatgtcagaccctgggttcccagcccactctctaccagatccctagcctc
tactgttcctatgagaccaattccaacgcctacctgctgctccagcccatccggaaggag
gtcatccacctggagccctacattgctctctaccatgacttcgtcagtgactcagaggct
cagaaaattagagaacttgcagaaccatggctacagaggtcagtggtggcatcaggggag
aagcagttacaagtggagtaccgcatcagcaaaagtgcctggctgaaggacactgttgac
ccaaaactggtgaccctcaaccaccgcattgctgccctcacaggccttgatgtccggcct
ccctatgcagagtatctgcaggtggtgaactatggcatcggaggacactatgagcctcac
tttgaccatgctacgtcaccaagcagccccctctacagaatgaagtcaggaaaccgagtt
gcaacatttatgatctatctgagctcggtggaagctggaggagccacagccttcatctat
gccaacctcagcgtgcctgtggttaggaatgcagcactgttttggtggaacctgcacagg
agtggtgaaggggacagtgacacacttcatgctggctgtcctgtcctggtgggagataag
tgggtggccaacaagtggatacatgagtatggacaggaattccgcagaccctgcagctcc
agccctgaagactga

DBGET integrated database retrieval system