KEGG   Homo sapiens (human): 2833Help
Entry
2833              CDS       T01001                                 

Gene name
CXCR3, CD182, CD183, CKR-L2, CMKAR3, GPR9, IP10-R, Mig-R, MigR
Definition
(RefSeq) C-X-C motif chemokine receptor 3
  KO
K04188  C-X-C chemokine receptor type 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04062  Chemokine signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    2833 (CXCR3)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    2833 (CXCR3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    2833 (CXCR3)
   04050 Cytokine receptors [BR:hsa04050]
    2833 (CXCR3)
   04090 CD molecules [BR:hsa04090]
    2833 (CXCR3)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Chemokine
   CXC Chemokine
    2833 (CXCR3)
Cytokine receptors [BR:hsa04050]
 Chemokine receptors
  CXC Chemokine
   2833 (CXCR3)
CD molecules [BR:hsa04090]
 Proteins
  2833 (CXCR3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 Ctr 7TM_GPCR_Srsx
Motif
Other DBs
NCBI-GeneID: 2833
NCBI-ProteinID: NP_001495
OMIM: 300574
HGNC: 4540
Ensembl: ENSG00000186810
Vega: OTTHUMG00000033326
Pharos: P49682(Tchem)
UniProt: P49682
Position
Xq13.1
AA seq 368 aa AA seqDB search
MVLEVSDHQVLNDAEVAALLENFSSSYDYGENESDSCCTSPPCPQDFSLNFDRAFLPALY
SLLFLLGLLGNGAVAAVLLSRRTALSSTDTFLLHLAVADTLLVLTLPLWAVDAAVQWVFG
SGLCKVAGALFNINFYAGALLLACISFDRYLNIVHATQLYRRGPPARVTLTCLAVWGLCL
LFALPDFIFLSAHHDERLNATHCQYNFPQVGRTALRVLQLVAGFLLPLLVMAYCYAHILA
VLLVSRGQRRLRAMRLVVVVVVAFALCWTPYHLVVLVDILMDLGALARNCGRESRVDVAK
SVTSGLGYMHCCLNPLLYAFVGVKFRERMWMLLLRLGCPNQRGLQRQPSSSRRDSSWSET
SEASYSGL
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atggtccttgaggtgagtgaccaccaagtgctaaatgacgccgaggttgccgccctcctg
gagaacttcagctcttcctatgactatggagaaaacgagagtgactcgtgctgtacctcc
ccgccctgcccacaggacttcagcctgaacttcgaccgggccttcctgccagccctctac
agcctcctctttctgctggggctgctgggcaacggcgcggtggcagccgtgctgctgagc
cggcggacagccctgagcagcaccgacaccttcctgctccacctagctgtagcagacacg
ctgctggtgctgacactgccgctctgggcagtggacgctgccgtccagtgggtctttggc
tctggcctctgcaaagtggcaggtgccctcttcaacatcaacttctacgcaggagccctc
ctgctggcctgcatcagctttgaccgctacctgaacatagttcatgccacccagctctac
cgccgggggcccccggcccgcgtgaccctcacctgcctggctgtctgggggctctgcctg
cttttcgccctcccagacttcatcttcctgtcggcccaccacgacgagcgcctcaacgcc
acccactgccaatacaacttcccacaggtgggccgcacggctctgcgggtgctgcagctg
gtggctggctttctgctgcccctgctggtcatggcctactgctatgcccacatcctggcc
gtgctgctggtttccaggggccagcggcgcctgcgggccatgcggctggtggtggtggtc
gtggtggcctttgccctctgctggaccccctatcacctggtggtgctggtggacatcctc
atggacctgggcgctttggcccgcaactgtggccgagaaagcagggtagacgtggccaag
tcggtcacctcaggcctgggctacatgcactgctgcctcaacccgctgctctatgccttt
gtaggggtcaagttccgggagcggatgtggatgctgctcttgcgcctgggctgccccaac
cagagagggctccagaggcagccatcgtcttcccgccgggattcatcctggtctgagacc
tcagaggcctcctactcgggcttgtga

DBGET integrated database retrieval system