KEGG   Homo sapiens (human): 2833Help
Entry
2833              CDS       T01001                                 

Gene name
CXCR3, CD182, CD183, CKR-L2, CMKAR3, GPR9, IP10-R, Mig-R, MigR
Definition
(RefSeq) C-X-C motif chemokine receptor 3
  KO
K04188  C-X-C chemokine receptor type 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04062  Chemokine signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    2833 (CXCR3)
   04061 Viral protein interaction with cytokine and cytokine receptor
    2833 (CXCR3)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    2833 (CXCR3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    2833 (CXCR3)
   04050 Cytokine receptors [BR:hsa04050]
    2833 (CXCR3)
   04090 CD molecules [BR:hsa04090]
    2833 (CXCR3)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Chemokine
   CXC Chemokine
    2833 (CXCR3)
Cytokine receptors [BR:hsa04050]
 Chemokine receptors
  CXC Chemokine
   2833 (CXCR3)
CD molecules [BR:hsa04090]
 Proteins
  2833 (CXCR3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 Ctr 7TM_GPCR_Srsx
Motif
Other DBs
NCBI-GeneID: 2833
NCBI-ProteinID: NP_001495
OMIM: 300574
HGNC: 4540
Ensembl: ENSG00000186810
Vega: OTTHUMG00000033326
Pharos: P49682(Tchem)
UniProt: P49682
Position
Xq13.1
AA seq 368 aa AA seqDB search
MVLEVSDHQVLNDAEVAALLENFSSSYDYGENESDSCCTSPPCPQDFSLNFDRAFLPALY
SLLFLLGLLGNGAVAAVLLSRRTALSSTDTFLLHLAVADTLLVLTLPLWAVDAAVQWVFG
SGLCKVAGALFNINFYAGALLLACISFDRYLNIVHATQLYRRGPPARVTLTCLAVWGLCL
LFALPDFIFLSAHHDERLNATHCQYNFPQVGRTALRVLQLVAGFLLPLLVMAYCYAHILA
VLLVSRGQRRLRAMRLVVVVVVAFALCWTPYHLVVLVDILMDLGALARNCGRESRVDVAK
SVTSGLGYMHCCLNPLLYAFVGVKFRERMWMLLLRLGCPNQRGLQRQPSSSRRDSSWSET
SEASYSGL
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atggtccttgaggtgagtgaccaccaagtgctaaatgacgccgaggttgccgccctcctg
gagaacttcagctcttcctatgactatggagaaaacgagagtgactcgtgctgtacctcc
ccgccctgcccacaggacttcagcctgaacttcgaccgggccttcctgccagccctctac
agcctcctctttctgctggggctgctgggcaacggcgcggtggcagccgtgctgctgagc
cggcggacagccctgagcagcaccgacaccttcctgctccacctagctgtagcagacacg
ctgctggtgctgacactgccgctctgggcagtggacgctgccgtccagtgggtctttggc
tctggcctctgcaaagtggcaggtgccctcttcaacatcaacttctacgcaggagccctc
ctgctggcctgcatcagctttgaccgctacctgaacatagttcatgccacccagctctac
cgccgggggcccccggcccgcgtgaccctcacctgcctggctgtctgggggctctgcctg
cttttcgccctcccagacttcatcttcctgtcggcccaccacgacgagcgcctcaacgcc
acccactgccaatacaacttcccacaggtgggccgcacggctctgcgggtgctgcagctg
gtggctggctttctgctgcccctgctggtcatggcctactgctatgcccacatcctggcc
gtgctgctggtttccaggggccagcggcgcctgcgggccatgcggctggtggtggtggtc
gtggtggcctttgccctctgctggaccccctatcacctggtggtgctggtggacatcctc
atggacctgggcgctttggcccgcaactgtggccgagaaagcagggtagacgtggccaag
tcggtcacctcaggcctgggctacatgcactgctgcctcaacccgctgctctatgccttt
gtaggggtcaagttccgggagcggatgtggatgctgctcttgcgcctgggctgccccaac
cagagagggctccagaggcagccatcgtcttcccgccgggattcatcctggtctgagacc
tcagaggcctcctactcgggcttgtga

DBGET integrated database retrieval system