KEGG   Homo sapiens (human): 283450
Entry
283450            CDS       T01001                                 
Symbol
HECTD4, C12ord51, C12orf51, HEEL, POTAGE
Name
(RefSeq) HECT domain E3 ubiquitin protein ligase 4
  KO
K17849  E3 ubiquitin-protein ligase HECTD4 [EC:2.3.2.26]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    283450 (HECTD4)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.26  HECT-type E3 ubiquitin transferase
     283450 (HECTD4)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  HECT type E3
   283450 (HECTD4)
SSDB
Motif
Pfam: HECT
Other DBs
NCBI-GeneID: 283450
NCBI-ProteinID: NP_001103132
HGNC: 26611
Ensembl: ENSG00000173064
UniProt: F8VWT9
Position
12:complement(112160195..112382431)
AA seq 4428 aa
MGSSAAAAAAAAAAADSAQWLSVKEETIFLHDGLIRVTDLAELPSEILGAPEAADTDLEI
LTFETKNPSELAERLRSVCGNQSNAYARLLEYRLNALRGLWNAQRQLALEEQHERESSGD
EETLALLKRQGLLQQPEQAPFTSRMGLLLVFPLIQSQSRTDPSLCNITAEVLLNCLRDCQ
PLSLTKEPADCLNGIETLLCSWLEETSDTGRHIPHKQKENAAAALVALACARGSLKTFVH
TVHLLQKQTDLGSLPVADVLYRLLLLEGGPGSPSCLLGGKHIVSWGYEDMLPAPDSNTGS
SSENKDADLGRCLTADGLYLYTTNSVGRGVSKLGSGLHGTLRGFVYCRNEELEPGWVAFG
SGSLLHRPVSFDNKPHSLFQVIDQNTLQVCQVVPMPANHLPIGSTMSTVHLSSDGTYFYW
IWSPASLNEKTPKGHSVFMDIFELVVENGVFVANPLQERTILMRKEGESAKSINEMLLSR
LSRYRASPSATLAALTGSTISNTLKEDQAANTSCGLPLKMLRKTPIYTCGTYLVMLVPPP
GGSGSSATRSLFGGTSGLSSLKILASSLVYNISDGQFTSRADLIDAAGSSLGRGALVPGL
GACYDTVNNMLWTCSNDYIDQWCNPGNQAFHYVCQRLGVSHIITEPKEEAITTNEVINQL
LHHVGAMCIHQLNLLATNPNLPITSVLGKQHPIEAHHLSSICDIMEKAMVNGDTCIIRCI
LVVFQVVFKFFFSPQTERNRDIIRRSGLLLWQLLMAPKDQICPEIQKEVCLAISSGLNIL
YPGETEINNLLKLVLTEGERNSGLSQLRDVILTNLAEQLQNNRFGSDEDDHYRLNDELLH
YILKIVVRESCILITKCQTVSKDDFQKLLSTVPAASSCLRYLMAVQNHLLSNTILIKPDE
NDDSDSSLQGETLKVQELKVSILALATQILTGCDEVLEMLQQVTTALINSDIADREQRLK
GLEQVTKATMLGHLLPVLLTSLMHPNLQTLIMADALMPQLVQLVLYTSQTALLLKTQCPV
FAEVGCSPCGAPDQKCRLFPDERMLEEKEEPGFLTGLKIPAPWAAGKTVETVHPVRDNYK
FKETVHIPGARCLYLRFDSRCSSQYDYDKLVIYAGPNTNSRKVAEYGGNTLGYGSRSVLG
TGWPKDLVKCISPPSLNFKVEGDTVTFSFEMRSGREHNTPDKAMWGFACTVRAQESSEDV
SGGLPFLVDLALGLSVLACSMLRILYNGPEITKEEEACQELLRSKLLQRCQWQVEANGVI
SPALTPSPSPLPLTIEEDREFTYPSDVLVPPVGNYFDLPRIRLPPGIMIKLREISGRARP
QFRPSIKEVIQPDVMEEMVVSCVIKHLNLVDALQSLINFQYQEEHAEEYDLLCKIMGETF
KKLNAMERQLQSVAELEQKWQSEVDDAMQGKLENNMPFFYDYHFNENKMKELELLCSMKE
VSFDGNDLENMVLSLREKFLQEVNSLIQKPSHPLAKTKTLVKSLMNRAELLLHVTIAAQS
GLTRSISGTPAETPACKSASETKVISHAVRQPVFLRSMSAPSDLEMIGNEDLEFTRANQR
RRHVTSHRSSSFTLLQSLAIEDSRDKPTYSVLLGQLFAFIGTNPDQAVSSSSFLLAAQTR
WRRGNTRKQALVHMRELLTAAVRVGGVTHLVGPVTMVLQGGPRIEELTCGGMVEQVQEAF
GETMTSVVSLCARYPIACANSIGLLCTIPYTRSEEKCLVRSGLVQLMDRLCSLSNQTESS
SSEKQTKKQKVATMAWAAFQVLANRCVEWEKEEGGSTEAVHSGLARQVSSLLTNHLARAT
ECCGNQAAGNDALQDVLSLLNDLSRSHIGKAILSQPACVSKLLSLLLDQRPSPKLVLIIL
QLCRAALPLMSVEDCGNVELPPWSYSVPSLNSEQEDPSDPASKIASLLLAKLADYVVPGC
QTVLSPTASEPDTTLTKTSPKNSLKGDKDPGEESEAVDGKLSIFIHKREDQSSHEVLQPL
LSSSEGRPFRLGTGANMEKVVKMDRDMTKGGCCEVITEEAAAALRKATKWAQSGLIVSIG
PPVESINPETVSGLSTGDKKKTAQTSICRERNSELARTDPVRPFISGHVANSMAAEVIAL
LHSLLMAPESNAAQIWTTTAEKVLSRALMYIPQLGKYAESILENGSSSGRKLAKLQRIAR
QAVAALCALGGFKETIKIGSEVQVLGRGISGSIGVVASINEQEGIATVRFPPIDCRKTSQ
ASDTLTIPLSRLCVPRSEALPLHKLSITEKVVQAVQSMLLPQEGSLSIHTSLPATGDGSA
PVMAVVRLLAEIRTRACLVMAQLLEDSLFCEEFIQQCPAAVEVLNLVAQECSAGERLAVV
EVQCERLRMLYRDCARPPPPPLQADRRQPKEITWSPSRVFPPVRACMFSSHLTSVTFLAD
PSAGGGLPRGTFIYATSPLPVQAPSFYWEIEIVSYGDTDDDTGPIVSFGFTTEAEKRDGA
WTNPVGTCLFHNNGRAVHYNGSSLLQWKSVRLDVTLSPGDVAGIGWERTEGTPPPPGQPA
KGRVYFTYCGQRLSPYLEDVSGGMWPVVHIQKKNTKTRANFGSRPFAYAEGQAHRNAADL
CTDLAEEISANFEALPFAMASDSDNDAGTSIASDPGTHGPPCRIAAVATAQQQYDSDTSC
HYKVELSYENFITSGPDPHPPPIADDESDDDDDDDIPQEDHYALLVKAWETKVFPTIRRR
FRNEAERKSGLDQIKGALQLGMVDIARQTVEFLYEENGGIPRDLYLPTIEDIKDEANKFT
IDKVRKGLTVVTRSPDSNNVASSAVGTALPKFAIRGMLKTFGLHGVVLDVDSVNELVQVE
TYLRSEGVLVRYWYPIDMLERPPAGYRRTATNGLVTLDNTNLQIHRELLRCEAALARLYC
RMALLNIFAPKLPHLFTRLFHIPAIRDITLEHLQLLSNQLLAPPLPDGTISSSSILLAQS
LQHCIHSQNCSATDLFYQGNSQTVREWLNVAITRTLHQGEESLLELTKQICSFLQTAPEQ
FPSEEFPISESKVNMDVNFPGAAFVVVSCKESQSGFRKDSSLYKAPWARVLVYGLGHKVK
RNGQLNLIEAACYPRDASPANTGLAPPPTADQYPSVVLSTDRVHIKLGVSPPPGAVLVLH
SLPLEFPLAMAFAEQLLSWKSEDSEGKSEDEPDTIPTSVLLQVVELLGNFLWTTDMAACV
KELVFHLLAELLRTVHTLEQRRHPAGLSSSIALQLNPCLAMLMALQSELHKLYDEETQNW
VSGGACGGSGGAAAGDQGRFSTYFHALMEGCLAVAEVTLPTNMSVTASGVTSATAPNLSD
SSSSSSSSPGQTPQSPSLLSKRKKVKMKREKASSSGKRQSSRTVDSDPTVLSIGGSKPED
MLWFHRALTLLIILRHLTRKDPQGLGVTSDAIADACQALVGPTAHSRLLVISGIPTHLDE
GVVRGAIRKACNAHGGVFKDEIYIPLQEEDTKKPKDKAEGGDGKVEPEKTLAFPGTDSME
VSTSSSLTPAMSISASASTSQASICSSQGISQTVSDLSVDPLPAGLELPIPPGLLEPHAV
SSQESLDISLCSTGSLGSLGSLGEPLDNAETASVSDMGSMYTVTSLDNQPLAARPIKGFA
VVEIRSRAKIEKIRASLFNNNDLIGLSSLDGEDELMEMSTEEILTVSVVNQSLFDTQGSP
GLEDYFNDKSIKGEKLVPGAREVLTEIFKSCAHSEQTLSLTPAKPIRVSDIYLSKEQINS
QTPGNLLHLFFTNVRPPKKVLEDQLTQILRKYGVPKPKFDKSKYSKAGKEQHPVKVVSTK
RPITKPPAKDKAVLNSVSRTALSEKKPTVKPKSPEKSKPDEKDPEKSPTKKQEVPEEKYL
TLEGFHKFVIDRARQDIRSVWRAILSCGYDLHFERCACIDVRHAQKASRKWTLEMDVALV
QYINQLCRHLAITPARLHPHEVYLDPADAADPRVACLLNVPIESLRLRFALLQSLNTTLE
TFFLPLVELRQTPMYTHSIAALLKEAKGLIFYDTKVTVMNRVLNATVQRTADHAAPEITL
DPLEIVGGEIRASENSYFCQAARQLASVPSSQLCVKLASGGDPTYAFNIRFTGEEVHGTS
GSFRHFLWQVCKELQSSSLSLLLLCPSSAVNKNKGKYILTPSPITYGEEQLLHFLGQLLG
IAIRADVPLPLDLLPSFWKTLVGEPLDPEQDLQEADILTYNYVKKFESINDETELEALCA
EIASQHLATESPDSPNKPCCRFTYLTMTGEEVELCSRGRHILVAWENKDIYAAAIRSLRL
RELQNVECVTAVRAGLGSIIPLQLLTMLSPLEMELRTCGLPYINLEFLKAHTMYQVGLME
TDQHIEFFWGALEMFTQEELCKFIKFACNQERIPFTCPCKDGGPDTAHVPPYPMKIAPPD
GTAGSPDSRYIRVETCMFMIKLPQYSSLEIMLEKLRCAIHYREDPLSG
NT seq 13287 nt   +upstreamnt  +downstreamnt
atgggctcgtcggcggccgcggcggcggcggcggcggcggccgctgactcggcgcagtgg
ctctcggtgaaggaagagaccatcttcctgcacgacgggctgatccgggtcaccgacctg
gccgagctgcccagcgagatcctcggggccccagaggccgcggacaccgacctggagatt
ttaacctttgagaccaagaacccgtcggaattagcagaacgtttgcgctctgtttgtggg
aatcagagcaatgcctatgcccggctgctggaataccgcctgaatgccttgcgaggactg
tggaatgcccagcgccagctggccttagaagaacagcatgaaagggaaagttcaggtgat
gaggaaactttggccctgctcaaacgccagggcttgttgcagcaacctgagcaagcgccc
ttcacatcgaggatggggctcctgctggtcttcccccttattcagtcccagagtagaaca
gacccctctctctgtaacataactgctgaggtgctattgaactgccttcgtgactgccag
cctttgagcttgaccaaggagcctgctgactgtctcaatggaattgaaactttgctgtgc
tcttggctagaggagacttctgacacaggccgacacatcccacataagcaaaaagaaaat
gctgctgctgccctggtggctttggcttgtgccaggggatcattgaaaactttcgtccac
acagtccatctattacagaaacagacggatctagggtccctgcctgtagctgatgtgcta
tataggctgttgcttttggaaggggggcctggatctccctcctgtttgcttgggggcaaa
cacatagtatcatggggttatgaagacatgttgcctgcgccggatagcaacactggctcc
agttctgaaaataaagatgctgacttgggacgctgtctcacggcagatggtctttacctg
tatactactaactcagttggaagaggagtaagcaaattgggatctggattacatggtact
ctcagaggttttgtgtactgccggaacgaggagttggaaccaggatgggtggcttttggc
agcggcagtcttctccaccggcctgtctctttcgataataaacctcactcccttttccag
gtcattgaccagaacacccttcaggtgtgccaggtggtgccaatgccagccaatcacctc
cccattggcagcaccatgagcactgtgcacctgtcttcagatggcacttacttctattgg
atctggtctcctgccagcctgaatgagaaaacaccgaagggacattctgtcttcatggac
atttttgaacttgtggttgaaaatggtgtatttgtagccaacccacttcaggaacgtaca
attctaatgagaaaagagggcgaatctgccaaaagcattaatgagatgcttctaagtaga
ctttctcggtatagagcctccccgtcagcaacgcttgctgccctgactggttccaccatc
tccaacacactgaaagaggatcaagcagcaaatactagctgtgggctgcctctaaaaatg
ctgcggaagacacccatatatacctgtggcacctacttggtgatgctggtgcctcctcca
gggggatcaggcagctctgccacccgatctctttttggtggaacaagtggtttgtcatct
ttaaaaatcctagcctccagcttggtgtataatatttcggatggtcagtttacaagtcgt
gcagatctcatagatgctgctggaagctcactggggcgtggtgctctcgtaccaggattg
ggagcgtgttatgacacagtgaacaacatgctatggacatgctcaaatgactatatcgat
cagtggtgtaaccctgggaatcaagccttccattatgtctgccagagacttggagtcagt
cacattatcactgagcccaaagaagaggctataaccacgaatgaggttataaaccaatta
ttgcaccacgttggtgcgatgtgcatacaccaactcaatcttcttgccaccaaccccaat
cttccaatcacaagtgtcttgggcaagcagcatccaattgaagcacatcatcttagcagt
atttgtgacattatggagaaggccatggttaatggagatacctgtattatacgctgcatt
ctcgttgtctttcaggtggtatttaaatttttcttcagcccacaaactgaaaggaatcga
gacatcattcgacggtcgggattgcttctttggcagttgttgatggctccaaaagatcaa
atttgccctgaaattcagaaggaagtctgccttgccatcagctctggtttaaatatcttg
tacccaggtgaaactgaaatcaataacttacttaaactggtcttaacagaaggagagaga
aacagtggactctcccagctacgggatgtgatcctaaccaacctggctgaacagctccaa
aacaaccgatttggcagtgatgaggatgatcattacagactaaatgatgaacttttacac
tacattctgaagattgttgtacgagaatcctgtatcttaatcaccaagtgccaaactgtc
tctaaagatgattttcaaaagctcctttcaactgtgcctgctgcatcctcctgcctgcgc
tatctgatggcagttcagaatcaccttctcagtaacactattttgattaaacctgatgag
aatgatgacagtgacagctccttgcagggagagacattgaaggtacaggagctaaaagtc
agtattttggctcttgccacccaaatcctgactggatgtgatgaagtgttggaaatgcta
cagcaggtcacaactgccctcataaatagtgacatagcagaccgtgagcagaggttaaaa
ggcttggaacaagttactaaggctactatgcttggtcaccttcttccagtgttactgacc
tccttgatgcatccaaatttacagactctgatcatggcggatgccctgatgcctcagcta
gtgcagctggtactctataccagccagacggcgttgctgcttaaaacccagtgtccggtt
tttgctgaggtgggctgttccccgtgtggtgcaccagaccagaagtgcaggctgttccct
gatgagagaatgttagaagagaaggaagagccaggatttctcactggtttaaagattcct
gccccatgggctgctggaaagactgtggaaacagtccaccccgtcagagacaactataaa
tttaaagaaacggtccatatcccaggagctcgctgcctgtaccttagatttgatagcaga
tgctcttcgcaatatgactatgacaaattggtgatatatgcggggcctaacacaaacagt
aggaaggttgctgaatatggaggcaacacactgggatatggcagccgtagtgtcttagga
actggttggccgaaagacttggtgaagtgcatttcccccccttccttaaattttaaggtg
gaaggagatacagtcaccttctcctttgaaatgagaagtggccgtgaacacaacactcct
gataaagccatgtggggctttgcttgcacagttcgcgctcaggagtcttcggaggatgtc
tcaggaggcttgccctttctggtagacctggctttaggtctgtctgtgttagcttgttcc
atgttaagaatcctgtacaatggaccagaaattaccaaagaagaagaagcctgtcaggag
ctattgcggtccaaacttttacaaaggtgccagtggcaggtggaggccaatggcgtgatc
tcccctgcccttactccgagcccctctccactgcctctgaccatagaggaagacagagaa
ttcacctacccctctgatgtcctcgtgcctcctgttggaaactactttgatctgcctcgg
atcagactgcctccaggaatcatgataaagctcagggaaatttctgggcgtgctagacct
caatttagaccaagtataaaagaagtgattcagccagacgtgatggaggaaatggtggta
tcttgtgttattaagcacttgaacttggttgatgcactgcagtctctaataaatttccaa
tatcaagaagaacatgctgaagaatatgatttattatgtaaaattatgggagagaccttt
aagaaactcaatgccatggagagacagctgcagagtgttgcagaactggaacaaaaatgg
caaagtgaagttgatgatgccatgcaggggaaactggagaacaacatgcctttcttttat
gattaccattttaatgagaacaaaatgaaagaactagaacttttatgttcaatgaaggaa
gtctcctttgatgggaatgatcttgaaaacatggtcctatcactgagggagaagttccta
caagaagtgaattctcttattcagaaaccctcacacccactggctaaaacaaagacgtta
gtgaagagtttaatgaaccgagccgagctgttgctgcatgtcaccatcgcagcccagtcg
ggcctcacgagaagcatctctgggacccctgctgaaacaccagcttgtaaatcagcttct
gaaacaaaagtgatatctcacgctgtcaggcagcctgtttttcttcgcagcatgtcagct
ccttctgacctggaaatgattggtaatgaagatttggaatttactagagcaaatcagagg
cgtcgccacgtgaccagccaccgcagcagctcctttacactcctgcagtcgctggccatt
gaggacagcagggacaagcccacctacagtgtcctgctagggcagctgtttgctttcatc
ggcaccaaccctgaccaagctgtgtccagcagcagtttccttttggctgcacagacaagg
tggcggcggggaaacactcgcaagcaggcactggtgcacatgcgggaattgctgacagct
gccgtacgagtcgggggagtgacgcatcttgtgggtccagtgacgatggtccttcaggga
ggacccagaattgaagaactcacatgtggtgggatggtcgagcaggtccaggaagccttt
ggcgagaccatgacctctgttgtgtctctgtgtgctcgttaccctatcgcttgcgcaaat
agcattggactcttatgtaccataccttacaccaggagcgaagagaagtgcctggtacgc
agtggccttgtgcagctcatggatcgactgtgtagcttgagcaatcagaccgagtccagc
tccagtgagaaacagaccaagaagcagaaggtggccaccatggcctgggctgccttccag
gtgcttgccaaccgctgtgttgagtgggaaaaagaggaaggtggctccacagaggctgtg
cactcaggtctggcccggcaggtgtccagccttctcactaaccatcttgcccgagccaca
gagtgctgtggcaaccaggctgctgggaatgacgcgctccaggatgtccttagtcttctc
aatgatctctcaaggagccacataggtaaagccatcctgagccagccagcttgtgtgtcc
aaactcctctccctgctgcttgaccaacgcccgtctccaaagctagtccttattattctc
cagctgtgccgggcggcgctgcccctgatgagcgtagaagactgtggaaacgtggagctc
ccaccctggagctactctgtcccctccttaaacagtgagcaggaggatcccagcgaccca
gcttccaagatcgcctccctgctcttagcaaagctggcagattatgtggttccaggatgt
cagacagttctttctccaaccgcttctgaacctgacaccacattgacaaaaaccagtccc
aagaattccttgaaaggagataaagatcctggagaagagagtgaggctgtggatggcaag
ctctcgatatttatccacaagcgggaagaccagtcatcccatgaagtcctccagccattg
ctaagtagttcagaaggacggcccttccgacttggtactggcgccaacatggagaaagtt
gtgaagatggatcgagacatgaccaagggtggctgttgcgaagtgattacagaagaggct
gcagccgccctgcggaaagccaccaagtgggcacagtcaggcctcatcgtcagcattggg
ccacctgtagagtctatcaacccagagactgtgagtggactatccacaggcgacaaaaag
aaaactgcccaaacttccatttgccgagagaggaactcggagcttgcaaggactgatcct
gtgcgtcccttcatcagtgggcatgtggcaaacagcatggctgcagaagtgatcgccttg
ctacatagcttgctcatggcacctgaatcaaatgctgctcaaatatggaccacaacagca
gagaaggttctgtctagagcactgatgtacattccacaattggggaaatacgcagaaagc
attctggaaaatggcagcagcagtggcaggaaacttgccaaacttcagagaattgcacgc
caggccgttgccgcactgtgtgcacttggaggcttcaaagagacaatcaagataggatcc
gaggttcaggttttaggtagaggaatttcaggaagcattggagtagtggcttctatcaat
gaacaggaaggtatagctacagtcagattcccacccatagactgtagaaagacttcgcaa
gcgtcagacacattgactattccattgtctagactttgtgttccaagatcagaggcattg
cctcttcataaactgtccattactgagaaggtagtacaggcagtccagtccatgttgctt
cctcaggagggaagtctctctattcacacctcacttcctgcaacaggagatgggtcagct
cctgtgatggcagtcgttcggctccttgctgaaataaggacaagagcatgcctggtcatg
gcccagcttttagaagacagcttattttgtgaagaattcatacaacaatgtccagcagct
gttgaagttcttaacctagtagcccaggaatgtagtgctggagagcgacttgcagttgtg
gaggtacagtgtgaacggctgaggatgctctaccgggactgtgctcggcccccaccacct
cctttgcaggctgaccgaagacagcccaaagagattacttggagcccctcgcgagtgttt
ccgcctgttcgagcctgcatgttctcatctcaccttacctcagtcaccttcctggctgac
cccagcgctgggggaggcctgccccggggcacttttatctatgccacttcaccactgcca
gttcaggccccgtctttttactgggaaattgaaatcgtttcctatggagacaccgatgat
gacaccggacccatagtttcctttggcttcactacagaagcagagaagcgagatggggct
tggactaatccagtgggcacttgtcttttccataacaacggccgagccgtgcactataat
ggctccagtttgttacagtggaagagcgttcgcttagacgtgactctctcccccggtgac
gtggcaggaattggctgggagagaactgaggggactccacctcctccgggacagccagcc
aagggccgggtgtacttcacatactgcgggcagcgcctctcaccatatcttgaagacgtc
tctggtggcatgtggccagtggttcacattcagaaaaagaacaccaaaacccgagctaac
tttggctcccggccgtttgcctacgcggaagggcaggcccaccgcaatgctgctgacctg
tgcactgacctagcagaagagatcagcgctaactttgaggccctgcctttcgccatggca
tctgacagtgacaatgatgctggcaccagtattgcatcagacccaggcactcatgggcca
ccatgccggattgctgccgtggccaccgctcagcaacaatatgatagtgacacctcctgt
cattataaagtcgagctcagctatgagaatttcatcacctctggcccagaccctcacccg
cctcccattgcagatgatgaaagcgatgatgatgacgatgatgacatccctcaggaggac
cactacgccctgctggtgaaagcatgggagaccaaggtttttcctaccatccgaagacgc
ttccgcaatgaagcagagcggaaatcgggcctggaccagataaagggggccttacaacta
ggtatggtggatattgcccgacagacggttgaatttctctacgaagagaatggtggcatc
ccaagagacctttatcttcccaccattgaagacattaaagacgaagcaaacaagttcaca
attgataaagttcgaaaaggtctcacagtagtaacccgctctccagacagcaataatgta
gccagcagtgctgttggaactgctctgccaaaatttgccatccgagggatgctgaaaacc
tttgggcttcatggagtcgtcttagatgttgattcagtgaatgaactggtgcaggtagaa
acgtacctccgcagtgaaggtgtgctggtgcgatactggtatcctattgacatgttggaa
aggcccccagcaggctaccgaaggactgccaccaatgggctggtcacactggacaatacc
aaccttcaaattcacagggagctgctgcgctgcgaggctgcgctggccaggctgtactgc
cgcatggccctgctcaatatcttcgccccgaagttgcctcacttgttcactcgcctcttc
cacatccctgccatccgggacattaccctggagcacctgcaactgctgtccaatcagctc
ctcgcacctcctctcccagacggcaccatcagctccagctcgatcctcctggcgcagtct
ttacagcattgcatccattcccagaactgctccgccacggacctcttttaccagggcaac
tcccagacagtgagagagtggctcaacgtggccatcacccggaccctgcaccagggcgag
gagagccttttagagctgacgaaacagatctgctctttcctgcagacagcaccagagcag
ttcccctccgaagagttcccaatttccgaatccaaagtcaacatggacgtgaatttcccc
ggggcagcttttgttgttgtgtcttgtaaagaaagtcaatctggattccgcaaagactcc
tctctgtacaaggcaccgtgggcacgggtgctcgtatatggcctcggccacaaagtgaag
cgaaatggccagctgaacctcatcgaggccgcctgttacccgcgggacgcgtccccagcc
aacactgggcttgcacctccccccaccgctgaccagtacccctctgtggtcctctccaca
gacagggtccacatcaaactgggggtgtctccacctcctggagcagtcctggtgttacat
tccctgcccctggagttcccactggctatggccttcgcagagcagctgctgtcctggaaa
tcagaggacagtgaagggaagtccgaagatgagcctgacaccattccgacatccgtcctc
ctgcaggtggtggagctgctaggaaacttcttgtggaccacggacatggcagcctgcgtg
aaggagcttgttttccatctcctggcagagctcctgcgcacggtgcacaccctggagcag
aggcggcaccccgctggcctgtcctcctcaatcgccctccagctgaacccctgcctggcc
atgctgatggccttgcagtcggagctccacaagctgtacgacgaggagacgcagaactgg
gtctcaggcggcgcctgcgggggctccgggggggcggcggccggtgaccagggcaggttc
tctacgtattttcatgcactcatggaagggtgcctggctgtggccgaagtgaccctgcct
actaacatgagtgtcacagccagtggggtgacctcagcgaccgccccaaatctcagtgac
tcgtcctcctcctcctcgtcctccccaggacagaccccacagagtcccagcctcctctcc
aagaggaaaaaagtcaagatgaagcgggaaaaggcctcctcgtcgggcaagcgccagtct
tcccgcaccgtggactcggaccccaccgtgctcagcatcggaggcagcaagcccgaggac
atgctgtggttccaccgcgcactcaccctgctcatcatcctccgccacctcaccaggaag
gacccacaggggctgggcgtgacgagtgacgccatcgccgatgcctgccaggccctggtg
ggccccaccgcccacagccgcttgctggtgatctccgggatccccacccacctggacgag
ggcgtagtcagaggcgccatccgcaaggcctgcaacgcccacggcggggtcttcaaagac
gagatctacatcccgctgcaggaagaagacaccaagaagccaaaagacaaggccgagggc
ggggacgggaaagttgagcccgagaagacactggccttccccggcacagacagcatggag
gtcagcacgtccagcagcctgacccccgccatgagcatcagcgcctccgcctccaccagc
caggcctccatctgcagctcgcagggcatctcccaaaccgtcagcgacctctctgtggat
ccgctgcctgccggcctcgagctgcccatccctccgggcctgttggagccccacgcggtg
tccagccaggaaagcctggacatttccctgtgcagcaccggcagcctgggcagcctgggc
agcctgggggagcccctggacaatgcagagacggcctcggtgtcggacatgggctccatg
tacacagtcacttccctggacaaccagcccctcgccgcccgccccatcaaaggcttcgca
gtcgtggagataagatcccgagccaaaattgagaaaattcgagcaagtttatttaacaat
aatgacttgattggtttgtcaagtttggatggtgaagatgaattgatggaaatgtcaaca
gaagagattctaaccgtgtctgtagtaaatcagagtctctttgatactcaagggagccca
gggttagaagattatttcaatgataagtcaattaaaggggagaagctggtgcccggagcc
agagaggttctgacggagatatttaagagttgtgcccattcagagcagacgctgagcctg
acaccagcgaagcccatcagagtctctgacatttatcttagcaaagagcagatcaactcc
cagaccccaggcaacctcctccacctcttcttcaccaatgtccggccgccaaaaaaggtg
ctggaggatcagctcacccagatcctgaggaagtatggcgtgccaaagcccaagtttgac
aagagcaagtacagcaaggccgggaaggagcagcaccccgtgaaggtggtgagcaccaag
cggcctatcaccaagccgcccgccaaggacaaggctgtgctcaacagcgtcagcaggact
gccttaagtgagaagaagccaactgtgaagccaaaatcaccagaaaagagcaaaccagat
gaaaaggacccagaaaagtcacctaccaaaaaacaagaagtccctgaggaaaaatacctg
acgctggaaggatttcacaaatttgttattgaccgagccaggcaagatatccgtagcgtc
tggagggcgatcttgtcctgtggttacgatcttcactttgagaggtgcgcatgcatcgat
gtccgacatgcacagaaggcctcaagaaagtggaccctggagatggacgtggcacttgtg
cagtacatcaaccagctatgccgccacctcgccatcacacccgcacggctccatccccat
gaggtgtacctggaccccgcggatgctgctgaccccagagtggcctgtctcctgaacgtg
cccatcgagagcctgcgcctgcgcttcgccttgctgcagtccctcaacaccacactggag
accttcttcctgcccctggtggagctgcgccagacacccatgtatacccacagcatcgcc
gccctgctgaaggaggccaaagggctgatcttctatgacacgaaggtgaccgtgatgaat
cgagtgctgaatgccactgtgcagaggacagcggaccacgcggcccctgagatcaccttg
gacccactggaaattgtgggaggggaaatcagagcttctgaaaactcctacttctgtcag
gctgccaggcagctggcctcagtgccgtcgtctcagctctgcgtcaagctggccagtggc
ggtgaccccacatatgccttcaacatccgcttcactggcgaggaggtccatggcaccagc
ggctctttccgccacttcctgtggcaggtgtgtaaggagctgcagagttcctcgctgtcg
ctgctgctgctgtgccccagctcagctgtcaataagaacaagggcaagtatatcctgacc
ccgagccccatcacctacggggaggagcagctgctgcacttcctggggcagctgctgggg
attgcaattcgggcagacgtcccgctgcccctggacctcctgccctccttctggaagacg
ctggtgggcgagcccttggaccctgagcaagacctgcaggaagcggatatcctcacctac
aattacgtcaagaagtttgagagcatcaatgatgagaccgagctggaggccctgtgcgct
gagatcgcctcccagcacctggccacggagagccctgacagccccaacaagccctgctgc
aggttcacctacctgaccatgacgggcgaggaggtggagctgtgcagccggggccggcac
atccttgtggcgtgggagaacaaggacatctacgcggcagccatccggagcctgcggctg
cgggagctgcagaatgtggagtgcgtgacggccgtgcgggccggcctgggctccatcatc
cccctgcagctgctgaccatgctcagcccactggagatggagctgcgcacctgcggcctc
ccctacatcaacctcgagttcctcaaggcccacaccatgtaccaagtggggctgatggag
acggaccagcacatcgagttcttctggggggccctggagatgttcacccaggaggagctg
tgcaagttcatcaagtttgcctgcaaccaggagcgcatcccgttcacctgcccctgcaaa
gatgggggtcccgacactgcccatgtgcccccgtaccccatgaagatcgcccccccagat
ggcacagcaggttccccagactctcgctacatccgcgtggagacctgcatgttcatgatc
aagcttccccagtactcctctctggaaatcatgctggagaaacttcgttgtgccattcac
taccgtgaagaccccctcagtggctga

DBGET integrated database retrieval system