KEGG   Homo sapiens (human): 283463Help
Entry
283463            CDS       T01001                                 

Gene name
MUC19, MUC-19
Definition
(RefSeq) mucin 19, oligomeric
  KO
K22020  mucin-19
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    283463 (MUC19)
Membrane trafficking [BR:hsa04131]
 Others
  Mucins
   Secretory mucins
    283463 (MUC19)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: VWD C8 TIL
Motif
Other DBs
NCBI-GeneID: 283463
NCBI-ProteinID: NP_775871
OMIM: 612170
HGNC: 14362
Pharos: Q7Z5P9(Tdark)
UniProt: Q7Z5P9
Position
12q12
AA seq 8384 aa AA seqDB search
MKLILWYLVVALWCFFKDVEALLYRQKSDGKIAASRSGGFSYGSSSSGDLDRKKPLFSLE
FGSPGETEDKSRQRQDAGSPKSEDTPAGGFFNSSSSSGDSDRTKPFFSLGLGAPGKAEDK
SGDSQDAGGSKSEDTPPGGFFYGSSSSGDSDKKKPLFSFEFGATGEDEDKSRERWDAGNS
RSEDSPADSTNTRYGAGFSSSGASLDVGFGWGISDEKGLEVSKADGRETRGSGSAGGETI
VFGPDAGSSVGTGSSGLKLGAGKGDAAFGFEVSDSNSFGDTGISSKTVEGNQTSSSGGSV
SIDLGDTSFRSENQFVGGGSLNSISNLWDSGQEGFGINEIGGNGMSGSVSAEAGFKGFGS
DSSSSGDSSARNGFENSSGISEDSGVILGSSDQHEVELSRTGGNRKRSSDPDEAGNLSPG
SDVSDSGGNTWSSDSGSGGGGVTSSSEYSTSGPLNTPEKGSHIPEATPKYSETNAIIGEI
STWSKGAYKSFNGRIFFFESSCPYTFCRHCIESGGDFNIEIKRNNDSEIEKITVLIDNND
VSIFGDTILVNGESVQIPYNNKLIHIKKYGEHNVLNSRRGILTLMWDKNNKLSLTLHKQY
PTCGLCGNFNSTPGQDINEHIANSKIPGDCPNAVGKSYEVCEDGIQHCNKIIGTYFEKCG
KVAALSNDYKMICIDEYCQTRDKTSTCDTYSELSRLCASDGPGTFESWRSDSDVVCGTQR
CPEQHIYKECGPSNPATCSNVAPFQDSECVSGCTCPEGYLLDDIGEKGKCVLKAECPCES
SGTVYQPGEVREGPCGSQCTCQDAKWSCTEALCPGRCKVEGSSLTTFDGVKYNFPGNCHF
LAVHNEDWSISVELRPCPSGQTGTCLNSVTLLLNSSVPVDKYVFNSDGTVTNDKIRNQGY
YYSDKIQIFNASSSYLQVETYFHVKLQIQIVPVMQLYVSMPPNQFTDTVGLCGSYNNKAE
DDFMSSQNILEKTSQAFANSWEMMSCPKGNPSSCISIEKEKFAERHCGILLDSSGPLASC
HPIVNPKPYHEECKKYTCTCENSQDCLCTILGNYVKACAEKETYIVGWRTGLCEHSCPSG
LVFKYNVKACNSSCRSLSERDRSCDVEDVPVDGCTCPDAMYQNNEGNCVLKSQCDCYIND
EVMQPGKLIHIDDNKCVCRDGILLCQIPIDLTLQNCSGGAEYVDCSDPKAQRRTNRTCST
RNIPVFDENLPCKRGCFCPEGMVRNSKGICVFPNDCPCSFGGREYDEGSVTSVGCNECTC
IKGSWSCTQNECQTICHIYGEGHVRTFDGKSYSFDGLCQYSFLEDYCGHENGTFRILTES
VPCCEDGLTCSRKIIVAFQDQNIVLQDGKVTAVKSTESKKCELNANAYSIHTVGLYLILK
FQNGIIVIWDKNTRLSVILDPNWNGKVCGLCGNNNGDLKDDFTTRYSSVASGALEFGNSW
KTSQECSDTVAQTFPCDSNPYCKAWAVRKCEILRDSTFRDCHNKVDPSAYHDACIEEACA
CDMEGKYLGFCTAVAMYAEACSAVGVCVSWRKPNLCPVYCDYYNAPGECRWHYEPCGTVT
AKTCKDQLVGQKFSSLLEGCYAKCPDSAPYLDENTMKCVSLSECSCFYNDVIPAGGVIED
NCGRTCYCIAGQLECSETAPTNSTFAVSTTTATTILSTGAAITLVTGGPSTAASIPAITT
SSSETTGTTLGPLTEPFTTGITETSVPIISTSGNAGMTGVVSPTVTGASGMAGTTGGVDA
ATTGAASENTSERAGTPRVSGETPAVGGGSTPGEAGPGATVSGSTGVSAGSITASPGASA
TSSESSKSGTTGPSVGGKTGATSSEATSSEGMSGVTGQSLGSTAGSDSEITAKTSFTGSS
PPGKLTRPSPGSPGHFSGGTTEWGNVATTGAAGENTSGALGSTEGSVEATTSAGSGNTAG
TSGTGDTGPGNTAVSGTPVVSPGATPGAPGSSTPGEADIGNTSFGKSGTPTVSAASTTSS
PVSKHTDAASATAVTISGSKPGTPGTPGGATSGGKITSGWSSSGTSTGASNTPGATGSST
GQTDTSGPSAKVTGNYGQSSEIPGTIKSSSDVSGTMGQSDTTSGPSVAVTRTSEQSSGVT
VASEPSVGVSGTTGPLAEISGTTRPLVSGLRTTGSSAEGSGTTGPSSRESVTTRPLAEGS
GTSGQSVTGSRATGLSATELGTTVSFTGGLGTSRSSARETRTTGPSADGSGTTGPSVVRS
GTTRLSVGVTRATESSPGVTGTTTPSAEESRTTGPSVLVTGTTGQSGQGSGTTGKSFIES
GPSVVGSGTTGPTSAGLGTTAPSTRRSSTTKPSVGRTGTTGQSGAESGTTEPSARVAGVT
GTSAEVSGRIEPSATESSTSRPLGETTGTTIPSMEGSEATGPSVIGSETTRLSVIGSGTT
GTSSGGSGATRSSGGGMGTTGQSTARSETTGPLFGLTGTFGQSATVTGTSSNSAGVTTPE
KSPGVAMTTGLLVEGSATTQPRILESETTESSAGVIVTSGQSARVTGATGPSAGETGTTE
PSTEGSVAAVLFVIGSETTRPLDIGSGTTGTLSGGSSTTRSSDGTTGTTRKSTARSETTG
LSGLTGTSGQLAGVTGTSSKSAGVTVTSEKSAGVAVITGSFVERPVTTGPPLLESETTRP
SGGVTVTSGQSARVTETVGASAGVTGTTGPSTEGSGATGPSVVGSGTTRPLAGESGTTES
SAGVTGTRPSSSRESATTGPSDEGSGTTGLSAGVTVTSGQSVRKTGTTGAPAGVTETTRP
SVVKSGTTGPSVIGTRTTGTSSGGSGATRSSGGETETTGQSAVKSGTTESFTRLTRTSGQ
SAGMTGTSAQSAGVALTSPFVEGLVTTGSSTVGLETTRPSAVGSGKTGPPVVKAQTTGPS
AGVTVTSGQSARMTGASGPSVGVTGTTGPASKGLGTIRPSVVGLETTELSAEGSGTTGPP
IVGETTVPSAGVTVTSGYSDRVTGATEPLAGVTGTIKPSVAGSVTTGPSVTGVETTAKTT
SGGLSTTISSVGGTGTTGQSPERSGTTGPFTGLTGTSAQSAGVTMTSIQSAGVLVTTGLN
VDGLGTTGKALIGSGTTGLSAEATGTIGPSTEGLEKTGPSITGSGTTRPLVTESWTAGTS
SGGHSTTSPSVRGTETTGQSAAESVTTGPVTGYTETSGPSAGVTVTPRQSPTVTQTTGSS
AAVSGTTVQSLTVSGTTRPSSGQTEITGSSVKESGTTESSAVRSGTTGPTAGVTGTNGPS
SAGVTGITGSSPGVTGTTGSSPGVTGTTGSSARSGTSIPSVGKTGTTRTSVEESRTTRPS
AGITGTNGLSAEVTGTTGPLAGVTGTTGPSAGVTRTTGLSAGETGTTGLSPGVTRTTRSS
AGLTGKTGLSAGVTGKTGLSAEVTGTTRLSAGVTGTTGPSPGVTGTTGTPAGVTGTTELS
AGVTGKTGLSSEVTETTGLSYGVKRTIGLSAGSTGTSGQSAGVAGTTTLSAEVTGTTRPS
AGVTGTTGLSAEVTEITGISAVVTGTTGPSAGVTETTGSSAGVAGTTRLSAGVTGITGLS
AGVTGTTGLSTEVTGTTGPSAGATGTTGLSVGVTGITGLSDVVTETTGSSARSGTGIPSV
GETRTTSTSVEESRTTRPSAGIMGTNGLPAEVTGTTEPLAGGTGTTGILAGVTGTTGLSA
GETGKIGSSAGVTGKTGSSARVTGKTGPSAEVTGKTGLSAGVTGTTGLSPGVTGTSGLSA
EVTGTTGPSAEATGLPGVSAGVTGTTGSLAGGTGTIGLSAGVTGTTGSSAGVTGTTGLSA
GVTGIAGLSAGVTGITGPSAGVTGTTTVSAGVTGTTGLSAEATEITGLSAGVTGTTGLSA
GVTETIRLSAGVTGTIRSSAGVTGITGLSAGVTGTTGPSAGVTGSTGLLAGVTETTGQSA
KVTGTTGQSVGVTGTTRSSGGVTGITGLSAGVTGTNGLSAVTGMTGLSAEVTGTTGLSVG
VTGIAGLSAGVTGITGPSAGITGTTTISAGVTGTSGLSAEATGITGLSAGVTGKTGLSAG
VTETIGLSAEATGTIGSSPGVTGTTGSSTGVTGITGLSAGVTGTTGLSTEVTGTTGPSAG
VTRTTGLSAGVTGITGLSAIVTETTGSSARSGTSIPSVGETGTTRTSVEESRTTRPSAGI
TGTNGLSAEVTGTIGPLAGGTGTTGLSAGVTGTVGSSAVVTGTTGLSAGVTGTTGPSAEE
TGATGPSAEVTETTGPSAGVTGTGRLSAEVTGTTGPSAEVTGLPGESAEVTGTIGSPAGV
TGTTQLSAVVTGITGLSAEVTGTTGLSAGVTGITGLSAEVTRTTGLSAGVTGTIGLSAGV
TGTTRPSAGVTGTTGQSAEVTGTTEPSAGLTETTGSSTGVTGATGPLAGVTGTTGISTEV
TGTTGPSARVTGTTVLSAGVTGITGLSAIVTETTGSSARSGTSTPSVGETGTTRTSVEES
RATRPSAGITGTNGQSAEVTWITGPLAGVTGTTGISAGVTGTTGLSAGVTGTIGSSAVVT
GINGLSAGVTGTTGPSAEETGATGPSAEVTGTTGPSAEETGATGPSAEVTGTTGPSGGVT
GTNGLSAEVTGTTGPSAEVTGLPGVSAGVTGTIGSPAAVTGTIRPSAVVTGITGLSAEVT
GTTGLSAWVTGIAGLSAGVTETIGSSAGVTGTNGLSAEATGTTGPSAGVTGTTGLSAGVT
GTAGLSARVTESTGLSAGVTGTTGLSAGVTGTTGPSAGITGTNGLSAEVTGTTGPLAGVT
GTIGLSAGVTGIAGLSAGVTESTGLSAGVTGTIRSSAVVTGINGLSAGVTGTTGPSAEET
GATGPSAEVTGTTGPSGGVTGTSGISAEVTGTTGPSAEVTGLPGVSAGVTGTIGSPAAVT
GTTRPSAVVTGISGLSAEVTGTTGLSAGVTETIGSSAGVTGTNGLSAEATETTGPSAGVT
GTTGLSAGVTGTTGPSAGIAGTNGLSAGVTGTTGLSARVTESTGLSAGVTGTIGSSAVVT
ETTRLSSGVTGTIGPSAEETGATGLSAEVTGTTGSLAEVTGTTGLSAGVTGTIGSSAVVT
GTTGLSAGITGTNGLSAEVTGTAGPLAGVTGTTGLSAGVTGTTGLSAGVTETTGQSAGVT
ESTGLSPGVTGTIGSSAVVTGIKGLSAGVTGTTGPSAEETGATGPSAEVTGTTGPSGGVT
GTSVLSVEVTGTTGPSAEVTGLPGVSAGLTGTIGSPAAVRGTTWPSAVVTGISGLSGEVT
GTTGLSAGVTGIGGLSAGVTGTIGSSAGVTGTNALSAEATGTTGPSAGVTGTTGLSAGVT
GTTGLSAGVTGTIRSSAVVTETTGLSAGVTGTTGPSAGIAGTNGLSAEVTGTTGLSAGMT
GTTGLSARVTESTGLSAGVTGTIGSSAVVTETTRLSAGVTGTIGPSAEETGATGLSAEVT
RTTGSLAGVTGTTGPSAVVTGKTELSAEVTGTTELSAEVTEKTGPSAEVTGKTGLSAGVM
ETTGPSAEVTGTTGSSAGVTGTTGPSAGVTGTTGPSAEATGLPGVSAGVTGTIGSPAGVT
GTARLSAVVTGISGLSAEVTGTTGLSTGVTGIAGHSAAVTGITRPSAGVTGTTTVSAGVT
GTIGLSAEATGITLPSAGVTETTGLSAGVTETIGLSAGVTGTIGSSAGVTEITGLSAGVT
GTTGPSAGVTGSTVLSAGVTATTGQSVGVTGTTGPSAGVTGTTGLSAGVTGIAGLSAGVT
GITGPSAGVTGTTTVSAGVTGTTGLSAEATEITGLSAGVTGTTGLSAGVTGIAGLSAGVT
ETIGSSAGVTGTNGLSAEATGKTGPSAGVTGTTGLSAGVTGTTGLSAGVTETIGLSAGVT
GTIGSSAGVKGTTGQSAEVTGATGQSVGVTGTTRSSGGVTGITGLSAGLRGTTVSSAKAG
TSIPLTGKTGTTRTSVEESTTTGPSAGITGTNGLSAEMTGTNELSAGVTGTIGSSAGVTG
TTGLSVEATVTTGLSAGVTGTTVPLAGVTWTPGPSAGVTGIAALSAGVTGKSGLSAGVTG
KTGLSAGVTGTTGPSAEATGKTGLSAGVTGITGPFAEVTGTTGLSAGVIGTTGSSAEVTG
ITGLSAGVTGKTRSSAGVTGTTGLSAKSGTSIPSAGKTGTTKTSVEESRTTRPSAGITAT
TGVPAATSPGAEGESIASTSVATGAIPRSTIAPGSTTTGTTGVTTGTTLAPRSFNIGTSG
GISGKTLKPGSYVSEATTATGTPGAGPSGGTTISSPEVSTISEVSNTGITGVGSETSIET
GISNTATTGVAPGTTLAPGSSSTEATTSIGGSASTRGGIATEATGSTRGVRTTGSEAPEG
TSGEFSGTTISSGGFHTEATTLTGGRGSIGTESRAESTTSLPQSAKTRGGILTEATSSTG
RIRATGSEAPGGTSRKFSGTTISSGGSHTEATTLAGGRDSTESEFRTATIGVVPATTVAP
GSSKTEATTFLGVSGTTSVGRATGATTSIAGSDTSQAEHPGGTSGEFPGTTITSGDSHTE
ATALTGSRGSIGTESTVETTTYIGESGTTRGGLATATTGAFSGKTLEPGNDNTEATGSTG
GIRATRTEAPGGTSGEFPGTTFTSGGSHTEATTFTGGKGSTGTESRAATTRAAPGTTLVP
GSSNTGATASPGGSATTRGRITTATTGAFSGKTLESENDNTEATSSTRGVRTTRSEAPGG
TSGEFPGTRITSGGSYTATTRAAPGTTLAPGSSNTGATASLGGSAMTRGRITTATTGAFS
GKTLEPGNNNTEATSSTRGVRTTRSEAPGEATTLTGDRSSTGSESRTATTGVAPGTTVAP
GSSKTEATTFLGVSGTTNIGRATGATTSIVGSDTSQAERPGGTTVVSPGASSTSQSSRPG
TSVTPDSSASESETVTTKEFSGTTAISRTSHTGTPAASGGQATGSLTATTGVAPGTTVAP
GSSNTEATTSVGERETTKAEIITGDTGELSGTTIISENSTTAGITAATGKQAGTSEVAPS
TTVAPGSFSTAATTSPGASGTTGVTTTTKTTTSLGGSGTTGAEIKSATTGAPGSRTGTAG
VPSATTVSPGSSNSEATTSVGESGKTGAETITEATTSTEGTGTSGTGFKTGTSEVAPATT
VAPGSFSTAATTSPGASGMTGVTTTTKTTTSLGGSGTTGAKIKLVGTTTTAPESRTAGVP
SGTRVTPGSSNSEATTSVEESRITRAEVITEATTFSGGSGATRAGLPRGTTGEFSGTNFI
SGSSNTEATTSTEGTGTSGTGFKIAGITSAPGKQAGTSGVSLATTVAPGSFSTATTSSGA
SGITRAGPTSETTTSLGGSGTTGAEIKSAAVPSGTTVAPGSSNSEATTSVGENGKTRGEI
ITDTTEGTSGKVLEPGSAHTEATTFPGGSGTTRAGPPGGTTGELSRMTIIPGSSNTEATT
STKGTGTSGTGFKTGTSWVAPGTTVSPGSFSTATISPGASRTTGAAPAAETTTSLEGGGT
TGAEIKSGATSGVPGSKTGTAGVPSATTIAPGSSNSEATTSLGESGKTRVETITGTTEGK
TLAAGSAHTEATTFSGGSGSTRAGPLGGASGTSGGYVPGRETEPTTSIEETGTSRTIFKT
VGITSAPGRQAGTSVVAPSTTVAPGSFSTAATTSPGASGMTGVRTTSKTTTSLGGTGTTR
TEIKSGATTGAPGIKTDIMGESSRTTILSGSSNTEATNSIEETGTSGTGFKTAGITAAPG
KQAGTSGVAPGTTVAPGSFSTAATTSPGASGVTGTGPTAETTTFLGGSSTTGAEIKSGAT
TGAPGSKTGTAKVLSGTTVASGSSNSEATTFSGITEAVTVPSKNGSMTTALGSQLSSSQT
VIPGSSGTISHTTVAPGSSVTGTTTGASDDQVTGSKTGTTGVALSTTVAPGSSSTEATTS
TGVHRTTVVGQKTGATTRGSAKQGTRSTIEATTSFRGTGTTGSGMNTGTTGVVSGNTISP
SSFNTEATSGTSERPNPGSEIGTTGIVSGTTVAPGSSNTEATTSLGNGGTTEAGSKIVTT
GITTGTTIVPGSFNTKATTSTDVGVATGVGMATGITNIISGRSQPTGSKTGYTVTGSGTT
ALPGGFRTGNTPGSTGVTSSQEGTTVVSSGITGIPETSISGPSKEASDKTTAPGPPTTVT
ASTGVKETSETGVQTGSTLVTAGVPTRPQVSQPETTVVATREVETENKTECLASLPPAPV
CHGPLGEEKSPGDIWTANCHRGTCTDAKTIDCKPEECPSPPTCKTGEKLVKFQSNDTCCE
IGYCEPRTCLFNNTDYEIGASFDDPSNPCVSYSCKDTGFAAVVQDCPKQTWCAEANRIYD
SKKCCYTCKNNCRSSLVNVTVIYSGCKKRVQMAKCTGECEKTAKYNYDILLLEHSCLCCR
EENYELRDIVLDCPDGSTIPYQYKHITTCSCLDICQLYTTFMYS
NT seq 25155 nt NT seq  +upstreamnt  +downstreamnt
atgaagttgatcttatggtacttggttgtggcactttggtgcttcttcaaagatgtggaa
gccttactttaccgacaaaaatcagatggtaaaatagcagcaagcagatcaggtggcttc
tcttatggtagttcatcctctggtgacttggacagaaaaaagccactctttagcttggaa
tttggttctccaggagagactgaagacaagtccagacaacgtcaggatgctgggagtcca
aagtcagaagacaccccagcaggtggcttttttaacagtagttcatcctccggtgactca
gacaggacaaagccattctttagcttaggacttggtgctccaggaaaggctgaagacaag
tccggagacagtcaggatgctggaggttcaaagtcagaagacaccccaccaggtggcttt
ttttatggtagttcatcctctggtgactcagacaaaaaaaagccactctttagctttgaa
tttggtgctacaggagaggatgaagacaagtccagagaacgctgggatgctgggaattca
aggtcagaagacagcccagcagatagcaccaacacaagatatggtgctggctttagtagc
agtggtgcctctctggatgtgggatttggttgggggatatctgatgaaaagggattggaa
gtcagtaaagctgatgggagagaaactagaggcagtggatctgctgggggtgaaaccata
gtctttggacctgatgcaggtagctcagttggaactggttcttctggtttgaaacttgga
gcagggaaaggtgatgctgcatttggttttgaagtttctgattcgaattcatttggtgac
actggcattagtagcaaaacagttgaaggaaatcaaacgagtagttctggaggatctgtt
tccattgatctaggtgataccagtttcagaagtgagaatcaatttgttggtggtggctct
ctaaattcgatatccaatttatgggattctggtcaagagggatttggaatcaatgaaatt
ggagggaatggaatgagtggcagtgtatctgctgaggctggattcaaaggttttggatct
gattcaagtagctcaggtgattcaagtgcaagaaatgggtttgaaaattctagtggtatc
tctgaagattcaggagtcatattggggtcatctgatcaacatgaagttgaactcagtaga
actggtgggaatagaaagagaagcagtgaccctgatgaggctggaaacttgagtcctgga
tctgatgtcagtgactcaggaggaaacacttggtcttctgattctggaagtggtggagga
ggtgtcacaagctcgtctgaatatagtacgtctggaccactcaatactccagaaaaagga
tcccacattccagaagcaactccaaaatactcagaaacaaatgcaattattggtgaaata
tctacctggagcaaaggagcatataaatctttcaacggccgcatctttttctttgaatct
tcatgcccatacactttctgccgtcactgcattgaatctggaggggatttcaatattgag
atcaaacgaaacaatgatagtgagattgaaaaaataacagttctaattgacaataacgac
gtctctatttttggtgacaccattttagttaatggagaaagtgtacagataccatataac
aataagttgattcacataaaaaaatatggagaacataatgttctgaatagccgtagagga
atcctgactttaatgtgggacaaaaataacaaactctcgctcactcttcacaagcagtat
ccaacttgtggtctttgtggtaacttcaacagcactccagggcaagatattaatgagcac
attgccaatagtaaaattcctggtgattgtcccaatgctgttggtaaaagctatgaagtt
tgtgaagatggaatacagcactgtaacaaaattattggaacctactttgagaaatgtgga
aaggttgctgctctatccaatgactacaaaatgatctgcattgatgaatactgccaaact
agagacaaaacatctacatgtgacacttattcagaactgtcccgcctctgtgcctcagat
ggtcctggcacctttgaatcctggcgaagcgactccgatgtggtttgtggaacacaaaga
tgtccagaacaacatatctacaaagaatgtggaccctccaaccctgcaacttgttctaat
gtggctccttttcaagacagtgaatgtgtgagcggctgcacctgcccagaaggttatctg
ttggatgacattggagagaaaggaaaatgtgtattaaaagctgaatgtccctgtgaatcc
agtggaacagtgtatcagccaggagaagtccgagaaggtccttgtggttctcagtgcaca
tgccaagatgcaaagtggtcttgcaccgaagcattatgccctggaagatgtaaggtggaa
ggaagttcccttaccacctttgatggtgttaagtacaactttcctggaaactgccacttc
ctggccgttcacaatgaagattggtctattagtgttgagctccgtccgtgcccaagtggt
cagacaggaacgtgcttaaatagcgttacacttctcttgaattcttctgttccagttgac
aaatacgtattcaacagtgatggaacagtcacaaatgacaagattagaaatcaaggttat
tactattcagataaaatacagatattcaatgcatcttcctcataccttcaagtagaaaca
tactttcatgtgaaactacaaatacaaattgttcctgtgatgcaattgtatgtttctatg
ccacccaaccaattcacagacactgtgggactctgtggttcctacaacaacaaagcagag
gatgatttcatgtcaagtcagaatatattggagaagacatctcaggcatttgctaactct
tgggaaatgatgtcctgtcctaaaggaaacccctcttcatgtattagtatagaaaaagaa
aaatttgctgaaaggcactgtggaattcttcttgattcaagtgggcctttggcttcctgc
cacccaattgtgaaccctaaaccctatcatgaggaatgcaaaaaatatacttgcacttgt
gaaaacagtcaggactgcctatgtacaattttaggcaactatgtgaaagcgtgtgctgag
aaggaaacatacatagtgggatggagaactggcctatgtgaacattcttgcccaagtggc
ctagtgttcaagtacaatgtaaaagcctgtaatagttcttgccgatccttgtcagaaaga
gataggagctgtgatgtagaagatgttccagttgatggatgcacctgccctgatgcaatg
taccagaataatgaaggaaactgtgtactgaaatctcagtgtgactgttacataaacgac
gaggtcatgcaaccaggcaaactcatccatattgatgacaataaatgcgtctgtcgggat
ggaattcttctttgccagattcccattgatttaaccctacaaaattgttctggaggggct
gagtatgtagactgcagtgatcccaaggcacagagaagaaccaacagaacatgcagtact
cggaacatacctgtttttgatgagaacttgccttgcaaacgtgggtgcttttgtccagaa
ggaatggttcgaaattctaaagggatatgtgtctttcctaatgactgtccatgctctttt
ggtggacgagaatatgatgaaggaagtgtcacttctgttggctgcaatgaatgtacctgc
attaaagggtcttggagttgtacccaaaatgaatgtcaaaccatctgccacatctatggg
gaaggtcatgttagaacttttgatgggaagagttacagttttgacggtctctgccagtat
tcatttcttgaggattattgtggtcatgaaaatggcacatttcgtattttaacggagagt
gttccatgctgtgaagatgggctaacgtgctcaagaaaaattatagttgcttttcaggat
cagaatattgtcttgcaagacggtaaagtaacagcagtcaaatctacagaaagtaagaaa
tgtgaactcaatgcaaatgcatactccatacatactgttggcctgtacttaattctgaaa
tttcaaaatggaataatcgtgatttgggacaaaaatacaagactgtctgttattctggat
ccaaactggaatggcaaagtgtgtggtctttgtggaaataacaatggtgatctcaaggat
gatttcacaacaagatactcttcagtagcttctggagcactggaatttgggaatagttgg
aaaacaagccaagaatgttcagatacagtggctcagactttcccatgtgattcaaaccca
tactgtaaagcctgggctgtgcggaaatgtgagatcctcagagacagcaccttcagagac
tgccacaacaaggttgaccccagtgcttaccatgatgcgtgcattgaagaagcctgtgca
tgtgacatggaggggaagtacctgggattctgcactgccgtggctatgtacgcagaggcg
tgtagtgcagttggagtctgtgtctcatggagaaaaccaaatctgtgtcctgtctactgt
gattactacaatgcgcctggggaatgcagatggcattatgaaccttgtggcacagtgact
gcaaaaacatgcaaagatcagctcgttggccagaaattttcttcacttttagaaggttgt
tatgctaagtgcccagatagtgctccttacttggatgagaacaccatgaaatgtgtcagt
ttatctgagtgcagctgtttctataatgatgtcataccagcagggggagtgattgaagat
aattgtggaagaacatgctactgcattgcagggcagttggagtgcagtgaaactgctcct
accaattcaacatttgcagtttccactacaacagctaccaccatattaagcaccggagca
gcaattacactggttaccggtggcccaagcacagcagcatccattccagcgattacaaca
tcaagcagtgaaacaacaggaacaactctaggtcctctcaccgaaccttttactacaggc
attactgaaacttcagttcccatcatctcaacatctggaaatgcaggcatgacaggagta
gtgagccccaccgtcactggtgcttcaggcatggcaggaacaactggaggagtggatgca
gccaccactggagctgctagtgaaaatacatctgagagagcaggcacaccgagggtatct
ggagaaacccctgcagtcggaggtggcagtacccctggagaagcaggccctggagccaca
gtttctggaagtacaggagtttctgcaggctccatcactgccagccctggagcctcagcc
acaagctctgaaagcagcaaatcaggaactactggaccctcagtgggtggaaaaactgga
gccacaagcagtgaagcgacatcatctgaaggcatgtcaggtgtaacaggacagtctctt
ggatctactgctggatctgacagtgaaatcacagctaaaacatctttcactggttccagt
ccacctgggaaactcaccaggccaagcccgggctcacctggtcactttagtggtggaaca
actgaatggggaaatgtagccaccactggagctgctggtgaaaacacttctggagcattg
ggttcaacagaagggtctgtggaagccaccaccagcgcaggcagtggaaacacagctgga
acatcaggtactggggacactggccctggtaacacagcagtctcaggcacacctgtggta
tcacctggagcaactcctggagctccaggtagcagcacccctggggaagcagacattgga
aacaccagttttggaaaatcagggaccccaacagtatctgctgcctcaactaccagtagc
cctgtgagtaaacacaccgatgcagcctcagccacagcagtgacaatctctggaagcaaa
ccaggtacacctggaacaccaggtggtgcaactagtggaggcaaaattacatctggatgg
tccagcagtggcaccagcacgggcgcttcaaatacaccaggggcaacaggatcatcgacc
ggacagacagacacaagtggaccatcagctaaagtaacagggaattatggacaatcatct
gaaataccagggacaattaaatcatcatctgatgtttcagggacaatggggcaatcagat
acaacatctggaccatcagttgcagtgacaaggacttctgaacaatcgtcaggagtcacg
gtggcatctgaaccatcagttggagtatcagggacaactggaccattagctgaaatatca
gggacaaccagaccattagtttcagggttaaggacaactggatcatcagctgaaggatca
gggacaactggaccttcatcaagagaatcagtgacaactagaccattagctgaaggttca
gggacaagtggacaatcggttacaggatcaagagcaactggattatcagctacagaatta
gggacaactgtgtcttttactggaggattaggtacaagtagatcatctgctagagaaaca
aggacaactggaccatcagctgacgggtcaggaacaactggaccatctgttgtgagatca
gggacaactagattatcagttggagtgacaagagcaactgaatcatcacctggagtgaca
ggaacaactacaccatcagctgaagaatccaggacaacaggaccatctgttctagtgaca
ggaacaactggacaatcaggccaaggatcagggacaactggaaaatcttttatagaatca
ggaccatctgttgtaggatcagggacaactggaccaacatctgcaggattaggaacaact
gcaccatcaaccagaagatcaagcacaacaaaaccatcagttggaagaactgggacaact
ggacaatcaggtgcagaatcaggaacaactgaaccatcagctagagtggcaggtgtaact
ggaacatcagctgaagtatcaggaagaattgaaccatcagctacagaatcaagtacaagt
agaccactaggtgaaacaacagggacaactataccatcaatggaaggatcagaggcaact
ggaccatctgtcattggatcagaaacaactagactatcagttataggatcagggacaact
ggaacttcatctggaggttcaggtgcaacaagatcatcaggtggaggaatggggacaact
ggacaatcaactgcaagatcagaaacaactggaccactttttggattgacaggaacattt
gggcaatctgctacagtgactgggacatcttcaaattcagctggagtgacaacacctgaa
aaatcacctggagtggcaatgacaacaggactgttggttgaaggatcagctacaactcaa
ccacgtattttagaatcagaaacaactgaatcatcagctggagtgatagtgacatctgga
caatcagccagagtgactggggcaactggaccatcagctggagagacaggaacaactgaa
ccatcaactgaaggatcagttgcagctgtattatttgttattggatcagaaacaactaga
ccattagatataggatcagggacaactggaactttatctggaggttcaagtacaacaaga
tcatcagatggaacaacagggacaaccagaaaatcaactgcaagatcagaaacaactgga
ctttctggattgacaggaacatctgggcaattggctggagtgactgggacatcttcaaaa
tcagctggagtaacagtgacatctgaaaaatcagctggagttgcagtgataacaggatca
tttgttgaaagaccagtcacaactggaccacctcttttagaatcagagacaactagacca
tcaggtggagtaacagtgacatctggacaatcagccagagtgactgaaacagttggagca
tcagctggagtgacaggaacaactggaccatcaactgaaggatcaggggcaactggacca
tctgttgtgggatcaggaacaactagaccattagctggtgaatcaggtacaactgagtca
tcagctggagtgacagggacaaggccatcatcatcaagagaatcagcaacaactggacca
tcagatgaaggatcaggaacaactggactatcagctggagtgacagtgacatctggacaa
tcagttagaaagactgggacaactggagcaccagctggagttacagaaacaacaagacca
tctgttgtcaaatcagggacaactggaccatctgttataggaacgaggacaactggaact
tcatcaggaggatcaggtgcaacaagatcatcaggtggagaaacagagacaactggccaa
tcagctgtaaaatcagggacaacagaatcatttactaggttgacaagaacatctgggcaa
tcagctggaatgactgggacatctgcacaatcagctggagtggcactaacaagtcctttt
gttgaaggattagtgacaactggatcatctactgtaggattagagacaactagaccttca
gctgtaggatcaggaaaaactggacctcctgttgtaaaagcacagacaactggaccatca
gctggagtgacagtgacatccggacaatcagctagaatgactggggcaagtggaccatca
gtaggagtgacaggaacaactggaccagcaagtaaaggattagggacaattagaccatct
gttgtaggattagagactactgaactatcagctgaaggatcagggacaactggaccacct
attgtaggagagacaactgtaccatcagctggagtgacagttacatctggatactcagat
agagtgactggggcaactgaaccattggctggagtaacaggaaccattaaaccatctgtt
gcaggatcagtgacaactggaccatctgttacaggagtagagacaactgcaaaaactaca
tctggaggattaagtacaactatatcgtcagttggaggaacagggaccactggacaatca
cctgaaagatcagggacaacaggaccatttactggattgacagggacatctgcacaatca
gctggagtcacaatgacatctatccaatcagctggagtgctagtaacaacaggactaaat
gttgatggcttagggacaactggaaaagctcttataggatcaggaacaactggattatca
gctgaagctacagggacaattggaccatcaactgaaggattagagaaaactggaccatct
attactggatcaggaacaaccagaccattagttacagaatcatggacagctggaacttca
tctggaggacatagtacaacaagtccatcagttagaggaacagagacaactggacaatca
gctgcagaatcagtgacaacagggccagttacaggatacacagaaacctctggtccatca
gctggagtgacagtgacacctcggcaatcacctacagtgactcagacaactggatcatca
gctgcagtatcagggacaactgtacaatctcttacagtatcagggaccactagaccatca
tctggacaaacagaaataactggatcgtcagttaaagaatcagggacaactgaatcatca
gctgtaaggtcagggactactggaccaacagctggagtgacaggtacaaatggaccatca
tcagctggagtgacagggataactggatcatcacctggagtgacagggacaactggatca
tcacctggagtgacagggacaactggatcatctgcaagatcagggacaagtataccatca
gttggaaaaacaggaacgactagaacatcagttgaagaatcaaggacaactagaccatca
gctggaataacaggtacaaatggactatcagctgaagtgacagggacaactggaccatta
gctggagtgacagggacaactggaccatcagctggagtgacaaggacaactggactgtca
gctggagagacagggacaactggactatcacctggagtgacaaggacaacaagatcatca
gctgggctaacagggaaaacaggactatcagctggggtgacagggaaaactggactgtca
gctgaagtgacagggacaactagactatcagctggagtgacagggacaactggaccatca
cctggagtaacaggtacaactggaacaccagctggggttacagggacaactgaactatca
gctggagtgacagggaaaactggactatcatctgaagtgacagaaacaactggattatca
tatggggtgaaaaggacaattggactatcagctgggtcgacagggacaagtggacaatca
gctggagtggcagggacaactacactatcagctgaagtgacagggacaactagaccatca
gctggggtaacagggacaacaggactatcagctgaagtgacagagataactggaatatca
gctgtggtgacagggacaactggaccatcagctggggtgacagagacaactggatcatca
gctggagtggcagggacaacaagactatcagctggagtgacagggataactggactatca
gctggagtgacagggacaactggactgtcaactgaagtgacagggacaactggaccatca
gctggggcgacagggacaactggactatcagttggagtgactgggataactgggctatca
gatgtagtgacagagacaactggatcatctgcaagatcagggacaggtataccatcagtt
ggagaaacaagaacaactagcacatcagttgaagaatcaaggacaactagaccatcagct
ggaataatgggtacaaatggactaccagctgaagtgacagggacaactgaaccattagct
ggagggacagggacaactggaatattagccggggtgacagggacaactggactatcagct
ggggagacagggaaaattggatcatcagctggggtgacagggaaaactggatcatcagca
agagtgacaggaaaaactggaccatcagcagaagtaacagggaaaactggactatcagct
ggagtgacggggacaactggactatcacctggagtgacagggacaagtggactatcagct
gaagtgacagggacaactggcccatcagctgaagctacagggctacctggagtatcagct
ggggtgacagggacaactggatcactagctggagggacagggacaattggactatcagct
ggggtgacagggacaactggatcatcagctggggtgacagggacaactggactatcagct
ggggtgacagggatagctggactctcagctggggtgacagggataactggaccatcagct
ggagtgacagggacaactacagtatcagctggagtaacagggacaactggactatcagct
gaagcaacagagataactggactatcagctggggtgacagggacaactggactatctgct
ggggtgacagagacaattagactatcagctggggtgacagggacaattagatcatcagct
ggggtaacagggataactggactatcagctggagtgacagggacaactggaccatcagct
ggtgtgacagggtcaactggactattagctggggtgacagagacaactggacagtcagct
aaagtgacagggacaactggacaatctgtcggagtgacagggacaactagatcatcaggt
ggagtgacagggataactggactatcagctggagtgacagggacaaatggactatcagct
gtgacaggaatgactggactatcagctgaggtgacagggacaactggactatcagttggg
gtgacagggatagctggactctcagctggcgtgacagggataactggaccatcagctgga
ataacagggacaactaccatatcagctggagtaacagggacaagtggactatcagctgaa
gcaacagggataactggactatcggctggggtgacagggaaaactggactatctgctgga
gtgacagagacaattggactatcagctgaagcgacagggacaattggatcatcacctggg
gtgacagggacaactggatcatcaactggggtgacagggataactggattatcagctgga
gtgacagggacaactggattgtcaactgaagtgacaggaacaactggaccatcagctggg
gtgacaaggactactggactatcagctggagtgactgggataactgggctatcagctata
gtgacagagacaactggatcatccgcaagatcagggacaagtatcccatcagttggagaa
acaggaacaactagaacatcagttgaagaatcaaggacaactagaccatcagctggaata
acgggtacaaatggactatcagctgaagtgacagggacaattggaccattagctggaggg
acagggacaactggactatcagctggggtgacaggaacagttggatcatcagctgtggta
acagggacaactggactatcagctggagtcacagggacaactggaccatcagctgaagag
acaggggcaactggaccatcagccgaagtgacagagacaactggaccatcagctggggtg
acagggacaggtagactatcagctgaagtgacagggacaactggcccatcagctgaagta
acagggctacctggagaatcagctgaggtgacagggacaattggatcaccagctggagtg
acagggacaactcagctatcagctgtggtgacagggataactggactatcagctgaggtg
acagggacaactggactatcagctggggtgacagggataactggactatcagctgaggtg
acaaggacaactggactatcagctggggtgacagggacaattggactatcagctggggtg
acagggacaaccagaccatcagctggagtgacagggacaactggacaatcagctgaagtg
acagggacaactgaaccatcagctgggttgacagagacaactggatcatcaactggggtg
acaggggcaactggaccattagctggagtgacagggacaactggaatatcaactgaagtg
acagggacaactggaccatcagctagggtgacagggacaactgtactatcagctggagtg
actgggataactgggctatcagctatagtgacagagacaactggatcatctgcaagatca
gggacaagtacaccatcagttggagaaacaggaacaactagaacatcggttgaagaatca
agggcaaccagaccatcagcaggaataacaggtacaaatggacaatcagctgaagtgaca
tggataactggaccattagctggagtgacagggacaactggaatatcagctggggtgaca
gggacaactggactgtcagctggggtgacagggactattggatcatcagctgtggtgaca
ggtataaatggactatcagcaggagtgacagggacaactggaccatcagctgaagagaca
ggggcaactggaccatcagctgaagtcacagggacaactggaccatcagctgaagagaca
ggggcaactggaccatcagctgaagtcacagggacaactggaccatcaggtggagtgaca
gggacaaatggactatcagctgaagtgacaggaacaactggcccatcagctgaagtgaca
gggctacctggagtatcagctggggtgacagggacaattggatcaccagctgcagtgaca
gggacaattcggccatcagctgtggtgacagggataactggcctatcagctgaggtgaca
gggacaactggactatcagcttgggtgacagggatagctggactctcagctggggtgaca
gagacaattggatcatcagctggggtgacaggtacaaatggactatcagctgaagcaaca
gggacaactggaccatcagctggagtgacagggacaactggactatcagctggggtgaca
gggacagctggactatcagctagggtgacagagagtacaggactatcagctggggtgaca
gggacaactggactatcagcaggagtgacagggacaactggaccatcagctggaataaca
ggtacaaatggactatcagctgaagtgacagggacaactggaccattagctggagtgaca
gggacaattggactatcagctggggtgacagggatagctggactctcagctggggtaaca
gagagtactggactatcagctggggtgacagggacaattagatcatcagctgtggtgaca
ggtataaatggactatcagcaggagtgacagggaccactggaccatcagctgaagagaca
ggggcaactggaccatcagctgaagtcacagggacaactggaccatcaggtggagtgaca
gggacaagtggaatatcagctgaagtgacaggaacaactggcccatcagctgaagtgaca
gggctacctggagtatcagctggggtgacagggacaattggatcaccagctgcagtgaca
gggacaactcggccatcagctgtggtgacagggataagtggactatcagctgaggtgaca
gggacaactggactatcagctggggtgacagagacaattggatcatcagctggggtgaca
ggtacaaatggactatcagctgaagcaacagagacaaccggaccatcagctggagttaca
gggacaacaggactatcagctggggtgacagggacaactggaccatcagctggaatagca
ggtacaaatggactatcagctggggtgacagggacaactggactatcagctagggtgaca
gagagtactggactatcagctggggtgacagggacaattggatcatcagctgtggtgaca
gagacaactagactttcatctggagtcacagggacaattggaccatcagctgaagagaca
ggggcaactggactatcagcagaagtgacagggacaactggatcattagctgaagtgaca
gggacaactgggctatcagctggggtgacagggacaattggatcatcagctgtggtgaca
gggacaactggactatcagctggaataacaggtacaaatggactatcagctgaagtgaca
gggacagctggaccattagctggagtgacagggacaactggactatcagctggggtgaca
gggacaactggactatcagctggggtgacagagacaactggacaatcagctggggtgaca
gagagtactggactatcacctggggtgacagggacaattggatcatcggctgtggtgaca
gggataaagggactatcagcaggagtgacagggaccactggaccatcagctgaagagaca
ggggcaactggaccatcagctgaagtcacagggacaactggaccatcgggtggagtgaca
gggacaagtgtactatcagttgaagtgacaggaacaactggcccatcagctgaagtgaca
gggctacctggagtatcagctgggttgacagggacaattggatcaccagctgcagtgaga
gggacaacttggccatcagctgtggtgacagggataagtggactatcaggtgaggtgaca
gggacaactggactatcagctggggtgacagggataggtggactctcagctggggtgaca
gggacaattggatcatcagctggggtgacaggtacaaatgcactatcagctgaagcaaca
gggacaactggaccatcagctggagtgacagggacaactggactatcagctggggtgaca
gggacaactggactatcagctggggtgacagggacaattagatcatcagctgtggtgaca
gagacaactggactatcagcaggagtgacagggacaactggaccatcagctggaatagca
ggtacaaatggactatcagctgaagtgacagggacaactggactatcagctgggatgaca
gggacaactggactatcagctagggtgacagagagtactggactatcagctggggtgaca
gggacaattggatcatcagctgtggtgacagagacaactagactatcagctggagtcaca
gggacaattggaccatcagctgaagagacaggggcaactggactatcagcagaagtgaca
aggacaactggatcattagctggagtgacagggacaactggaccatcagctgtagtgaca
gggaaaactgaactatcagcagaagtgacagggacaactgaactatcagctgaggtgaca
gagaaaactggaccatcagcagaagtgacagggaaaactgggctatcagctggagtgatg
gagacaactggaccatcagctgaagtgacagggacaactggatcatcagctggggtgaca
ggcacaactggaccatcagctggagtgacagggacaactggcccatcagctgaagcgaca
gggctacctggagtatcagctggggtgacagggacaattggatcaccagctggagtgaca
gggacagctcggctatcagctgtggtgacagggataagtggactatcagctgaggtgaca
gggacaactggactatcaactggggtgacagggatagctggacactcagctgcggtgaca
gggataactagaccatcagctggagtgacagggacaaccacagtatcagctggagtaaca
gggacaattggactatcagctgaagcaacagggataactctaccatcagctggggtgaca
gagacaactggactatctgctggagtgacagaaacaattggactatcagctggggtgaca
gggacaattggatcatcagctggggtgacagagataactggactatcagctggagtgaca
gggacaactggaccatcagctggtgtgacagggtcaactgtactatcagctggggtgaca
gcgacaactggacaatctgttggagtaacagggacaactggaccatcagctggtgtgaca
gggacaactggactatcagctggggtgacagggatagctggactctcagctggggtgaca
gggataactggaccatcagctggagtgacagggacaactacagtatcagccggagtaaca
gggacaactggactatcagctgaagcaacagagataactggactatcagctggggtgaca
gggacaactggactatcagctggggtgacagggatagctggactctcagctggggtgaca
gagacaattggatcatcagctggggtgacaggtacaaatggactatcagctgaagcaaca
gggaaaactggaccatcagctggagtgacagggacaactggactatcagctggagtgaca
gggacaactggactatctgctggggtgacagagacaattggactatcagctggtgtgaca
gggactattggatcatcagctggagtgaaagggacaactggacagtcagctgaagtgaca
ggggcaactggacaatctgttggagtgacagggacaactagatcatcaggtggagtgaca
gggataactggactatcagcaggattgagagggacaactgtttcatctgcaaaagcaggg
acaagtataccattaactggaaaaacaggaacaactagaacatcagttgaagaatcaacg
acaactggaccatcagctggaataacaggtacaaatggactatcagctgaaatgacaggg
acaaatgaactatcagctggggtgacagggacaattggatcatcagctggagtgacaggg
acaactggactgtcagttgaagcaacagtgacaactggactatcagctggagtgacaggg
acaactgtcccattagctggggtaacatggacacctggaccatctgctggagtgacagga
atagctgcactatcagctggagtgacagggaaaagtggactatcagctggagtgacaggg
aaaacaggactatcagctggagtgacagggacaactggaccgtcagctgaagcaacaggg
aaaactggactatcagctggagtgacagggatcactggaccatttgctgaagtgacaggg
acaactggattatcagctggggtgatagggaccactggatcatcagctgaagtgacagga
ataactggactatcagctggggtgacagggaagactagatcatcagctggagtaacaggg
acaactggattatctgcaaaatctgggacaagtataccatcagctggaaaaacaggaaca
accaaaacatcagttgaagaatcaaggacaactagaccatcagctggaataacagctaca
actggagtgcctgctgcaacttccccaggagctgaaggtgaaagcatagcttccacgtca
gttgccacgggagccatccctcggtcaacaattgcaccaggaagtaccactactggtacc
actggggtaaccactggcacaactcttgcccctagaagtttcaacataggaacttctggt
ggaatttctgggaaaaccctcaaacctggaagttatgtctcagaggctacaactgctaca
gggactcctggagcaggaccgtcaggaggcaccactatcagttctcctgaagtcagtacc
atttcagaagtttccaacacaggtatcactggagtaggctctgagacatctattgaaaca
ggaatttccaacacagctacgactggggtggctcctggcacaacccttgcccctggcagt
tccagtacagaggccacaacttccataggaggaagtgcatcaacaagaggaggaatagcc
acagaagccacaggttccacaagaggggtcaggaccactggatcagaagctccagaaggt
acttctggagaattctctgggacaaccatttcatctggaggcttccacacagaagccaca
actctcacaggaggtaggggcagtattggaactgaatccagagcagagtccacaacttcc
ctaccacaaagtgcaaaaacaagaggtggaatactgacagaggccacaagttccacagga
aggatcagggcgaccggatcagaagctccaggaggtacctcccgtaaattctctgggaca
accatttcatctggaggttcccacacagaggccacaactctcgcaggtggcagggacagc
actgaaagtgaattcagaacagccaccattggagtagttcctgctacaactgttgctcct
ggcagttccaagacagaggccaccactttcctaggagtaagtggaacaacaagtgttgga
agagccacgggggccacaacttccatagcagggagtgacaccagccaagcagaacatcca
ggaggtacttctggtgaattcccaggaacaaccattacatctggagattcccacacagag
gccacagctctaacaggaagcaggggcagtattggaactgaatccacagtagagaccaca
acatacattggagaaagtgggaccacaagaggtggattagccacggctaccactggggca
ttctctggaaagactctggaacctgggaatgacaacacagaggccacaggttccacagga
gggatcagggccaccagaacagaagctccaggaggtacctctggtgaattcccagggaca
acatttacatctggaggttcccacacagaggccacaactttcacaggaggcaagggcagt
actggaactgaatccagagcagccaccactagggcagctcctggcacaactcttgtccct
ggcagttccaatacaggggccacagcttccccaggtggaagtgcaacgacaagaggtaga
ataaccaccgctaccactggggctttctctggaaagactctcgaatctgagaatgacaac
acagaggccacaagttccaccagaggggtcaggaccaccaggtcagaagcaccaggaggt
acttctggtgaattccctgggacaagaattacatctggaggttcctacacagccaccacc
agggcagctcctggcacaactcttgcccctggcagttccaacacgggggccacagcttcc
ctaggtggaagtgcaatgacaagaggtagaataaccaccgctaccactggggctttctct
ggaaagactctggaacctgggaacaacaacacagaggccacaagttccaccagaggggtc
aggaccaccagatcagaagctccaggagaggccacaactctcacaggagacaggagcagt
accggaagtgaatccagaacagccaccactggagtagctcctggcacaactgttgcccct
ggcagttccaagacagaggccaccactttcctaggagtaagtggaacaacaaacattgga
agagccacgggtgccacaacttccatagtagggagtgacaccagccaagcagaacgtcca
ggaggtacaactgtggtttcacctggagccagcagcacttcacagagctccaggccaggc
acctctgtcacaccagacagttcagcatctgaaagtgaaacagttactacaaaagaattc
tctgggacaactgctatatctagaacttcccacaccggcacccctgcagcctcaggaggc
caagcaactgggagcctgacagccaccactggggtagctcctggcacaactgttgcacct
ggcagttccaacacagaggccacaacttctgtaggagaaagagaaacaacaaaagctgaa
ataatcacaggtgacactggagaattatctggaacaaccattatatctgaaaattccacc
acagcaggcatcactgcagcaacagggaagcaagcaggcacctcggaggtagctccttcc
acaacagttgccccaggaagtttcagcacagcagccacaacttctcctggagcaagtgga
acgactggggttacaacaactacaaagaccacaacttccctaggaggaagtggcaccact
ggagcagaaataaaatcagccaccactggagcaccaggaagtaggacaggcacagctgga
gtgccctctgctacaacagtctcccctgggagctccaactcagaggccacaacttctgta
ggagaaagtggaaaaacaggagctgaaacaatcacagaggccaccacttccacagaaggg
actggtacttctggaactggattcaaaactggcacctcagaggtagctcctgccacaacg
gttgccccaggaagtttcagcacagcagccacaacttctcctggagcaagtggaatgact
ggggttacaacaactacaaagaccacaacttccctaggaggaagtggcaccactggagca
aaaataaaattagtaggaaccaccactacagcaccagaaagtaggacagctggagtgccc
tctggtacaagagtcacccctgggagctccaactcagaggccacaacttctgtagaagaa
agcagaataacaagagccgaagtaatcacagaggccacaactttctcaggaggcagcggg
gccacccgagcaggattacccagaggtaccactggagaattttctggaacgaactttata
tctggaagttctaacacagaggccaccacttccacagaagggacaggtacttctggaact
ggattcaaaattgcaggcatcacttctgccccagggaaacaagcaggcacctctggggta
tctcttgccacaacagttgcccctggaagcttcagcacagccacaacttcttctggagca
agtggaataactagggctggccccacctcagagaccacaacttccttaggaggaagtggt
accactggagcagaaataaaatcagcggcagtgccctctggtacaacagttgcccctggg
agctccaactcagaagccacaacttctgtaggagaaaatggaaaaacaagaggtgaaata
atcacagatactactgagggcacctctggcaaagttctggaaccaggaagtgcccacaca
gaggccacaactttcccaggaggcagtgggactacccgagcaggaccaccaggaggtacc
actggagaattgtctagaatgaccattatacctggaagttctaacacagaggccacaact
tccacaaaagggactggtacttctggaactggcttcaaaactggcacctcttgggtggcg
cctggcacaacagtttcccctggaagtttcagcacagccacaatttcccctggagcaagt
agaacgactggggctgcacctgccgcagaaaccacaacttccctagaaggaggtggcacc
actggagcggaaataaaatcaggagccacctccggagtaccgggaagtaagacaggcaca
gctggagtgccctctgctacaacaattgcccctgggagctccaactcagaggccacgact
tctttaggagaaagtggaaaaacaagagttgaaacaatcacaggtactactgagggtaaa
actctggcagctggaagtgcccacacagaggccacaactttctcaggaggcagcgggagc
acccgagcaggaccactgggtggcgcttctggtacatcaggaggatatgtccctggaagg
gaaacagagcccacaacttccattgaagaaactggaacttccagaactatattcaaaact
gtaggcatcacttcagccccagggaggcaagcaggcacctctgtggtggcgcctagcaca
acagttgcccctggaagtttcagcacagcagccacaacttctcctggagcaagtggaatg
actggggttagaaccacttcaaagactacaacttccctaggtggaactggcaccactaga
actgaaataaaatcaggagccaccactggagcaccaggaattaagacagatatcatggga
gaatcttctagaacgaccattctatctggaagttctaacacagaggccacaaattccatt
gaagagactggtacttctggaactggattcaaaactgcaggcatcactgcagcaccagga
aagcaagcaggcacctctggggtggcacctggcacaacagttgcccctggaagtttcagc
acagcagctacaacttctcctggagcaagtggagtgactggcactggacccactgcagag
accacaactttcctaggaggaagtagcaccactggagcagaaataaaatcaggagccacc
actggagcaccaggaagtaagacaggcacagctaaagtgctctctggtacgacagttgcc
tctgggagctccaactcagaggctacaactttctctggaatcactgaagcagtaacagtc
ccaagtaaaaatggatctatgaccactgcactggggagccaactctccagcagtcaaaca
gtgattccaggttccagtggcaccatctctcacacaactgttgcacctggaagttctgtt
acaggaaccaccactggtgcatcagatgatcaagtcactggaagtaaaacaggcactact
ggtgtggccttgagcacaactgttgcacctggaagttccagtacagaagccacaacttcc
acaggagtccatagaaccactgtagtgggacagaagacaggagctaccactagagggtca
gcaaagcaaggaactagaagcacaatagaagctacgacgtcctttagaggcactgggacc
acaggaagtggaatgaatacaggtactactggagtggtctctggcaacaccatctcacct
agcagtttcaacacagaagctaccagtggcacatctgagaggccaaaccctggaagtgaa
ataggcaccactggcatagtctctggcacaacagttgcacctggaagttccaacacagaa
gccacaacttctttgggcaatggtggaaccactgaggctggaagtaaaatagttaccact
gggataactactggcacgaccattgtacctgggagtttcaacacaaaggctaccacttct
acagacgttggagttgccactggagttggaatggcaactgggatcaccaacataatttca
gggagaagccaacctactggaagtaaaacaggctacactgtaacaggctctggaacaaca
gccttacctggaggtttcagaacaggcaataccccaggatcaacgggagtcaccagcagc
caagaaggaaccactgtggtatcaagtggaatcactggaatcccagaaacttccatctca
ggtccttccaaggaagcatctgacaaaaccactgctcctggacctcctaccacagtcact
gcttccacaggagtcaaagaaacttctgaaactggagtgcaaacaggctccaccttggtt
acagctggagtgccaacaagaccacaagtatcccagccagaaaccactgtcgtggcaacc
agagaagtagaaaccgaaaataaaacagaatgtctagcctcacttccaccagctccagtt
tgtcacggtccattgggagaagagaaatctcctggagacatatggactgccaattgccac
agaggtacctgtactgatgcaaagactatagactgtaaacctgaggagtgcccttctcca
cccacatgcaaaaccggcgagaagcttgtgaagttccaatctaatgacacctgctgtgaa
atcggatactgtgaaccaagaacatgtttatttaacaatactgactatgagattggtgct
tcattcgatgaccccagcaacccctgtgtctcctactcctgcaaagacacgggctttgct
gcagtagtccaggactgcccaaagcaaacctggtgtgcagaagcaaacagaatctatgat
tcaaaaaaatgttgctatacatgtaagaataattgcagatcttcccttgtaaatgtgact
gttatctacagtggttgcaagaaaagagttcagatggcaaaatgcacaggggaatgtgaa
aagactgccaagtacaattatgatatcttactcttggaacattcatgcctttgctgccga
gaagaaaactatgaactcagagacattgtacttgactgtcctgatggcagtacaatccct
taccaatacaagcatatcacgacctgctcttgtttagacatatgccaactatatacgacc
ttcatgtacagttaa

DBGET integrated database retrieval system