KEGG   Homo sapiens (human): 283471
Entry
283471            CDS       T01001                                 
Symbol
TMPRSS12, CT151
Name
(RefSeq) transmembrane serine protease 12
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: Trypsin DUF1986 Peptidase_S6 Trypsin_2
Other DBs
NCBI-GeneID: 283471
NCBI-ProteinID: NP_872365
HGNC: 28779
Ensembl: ENSG00000186452
UniProt: Q86WS5 A0A140VJY1
Position
12:50842926..50887884
AA seq 348 aa
MRLGLLSVALLFVGSSHLYSDHYSPSGRHRLGPSPEPAASSQQAEAVRKRLRRRREGGAH
AEDCGTAPLKDVLQGSRIIGGTEAQAGAWPWVVSLQIKYGRVLVHVCGGTLVRERWVLTA
AHCTKDASDPLMWTAVIGTNNIHGRYPHTKKIKIKAIIIHPNFILESYVNDIALFHLKKA
VRYNDYIQPICLPFDVFQILDGNTKCFISGWGRTKEEGNATNILQDAEVHYISREMCNSE
RSYGGIIPNTSFCAGDEDGAFDTCRGDSGGPLMCYLPEYKRFFVMGITSYGHGCGRRGFP
GVYIGPSFYQKWLTEHFFHASTQGILTINILRGQILIALCFVILLATT
NT seq 1047 nt   +upstreamnt  +downstreamnt
atgcggctggggctcctgagcgtggcgctgttgtttgtggggagctctcacttatactca
gaccactactcgccctctggaaggcacaggctcggcccctcgccggaaccggcggctagt
tcccagcaggctgaggccgtccgcaagaggctccggcggcggagggagggaggggcgcat
gcagaggattgtggaacagcaccgcttaaggatgtgttgcaagggtctcggattataggg
ggcaccgaagcacaagctggcgcatggccgtgggtggtgagcctgcagattaaatatggc
cgtgttcttgttcatgtatgtgggggaaccctagtgagagagaggtgggtcctcacagct
gcccactgcactaaagacgctagcgatcctttaatgtggacagctgtgattggaactaat
aatatacatggacgctatcctcataccaagaagataaaaattaaagcaatcattattcat
ccaaacttcattttggaatcttatgtaaatgatattgcactttttcacttaaaaaaagca
gtgaggtataatgactatattcagcctatttgcctaccttttgatgttttccaaatcctg
gacggaaacacaaagtgttttataagtggctggggaagaacaaaagaagaaggtaacgct
acaaatattttacaagatgcagaagtgcattatatttctcgagagatgtgtaattctgag
aggagttatgggggaataattcctaacacttcattttgtgcaggtgatgaagatggagct
tttgatacttgcaggggtgacagtgggggaccattaatgtgctacttaccagaatataaa
agattttttgtaatgggaattaccagttacggacatggctgtggtcgaagaggttttcct
ggtgtctatattgggccatccttctaccaaaagtggctgacagagcatttcttccatgca
agcactcaaggcatacttactataaatattttacgtggccagatcctcatagctttatgt
tttgtcatcttactagcaacaacataa

DBGET integrated database retrieval system