KEGG   Homo sapiens (human): 283518
Entry
283518            CDS       T01001                                 
Symbol
KCNRG, DLTET
Name
(RefSeq) potassium channel regulator
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: BTB_2
Other DBs
NCBI-GeneID: 283518
NCBI-ProteinID: NP_775876
OMIM: 607947
HGNC: 18893
Ensembl: ENSG00000198553
Pharos: Q8N5I3(Tbio)
UniProt: Q8N5I3
Position
13:50015444..50020922
AA seq 272 aa
MSSQELVTLNVGGKIFTTRFSTIKQFPASRLARMLDGRDQEFKMVGGQIFVDRDGDLFSF
ILDFLRTHQLLLPTEFSDYLRLQREALFYELRSLVDLLNPYLLQPRPALVEVHFLSRNTQ
AFFRVFGSCSKTIEMLTGRITVFTEQPSAPTWNGNFFPPQMTLLPLPPQRPSYHDLVFQC
GSDSTTDNQTGVRYVSIKPDNRKLANGTNVLGLLIDTLLKEGFHLVSTRTVSSEDKTECY
SFERIKSPEVLITNETPKPETIIIPEQSQIKK
NT seq 819 nt   +upstreamnt  +downstreamnt
atgagtagtcaggaactggtcactttgaatgtgggagggaagatattcacgacaaggttt
tctacgataaagcagtttcctgcttctcgtttggcacgcatgttagatggcagagaccaa
gaattcaagatggttggtggccagatttttgtagacagagatggtgatttgtttagtttc
atcttagattttttgagaactcaccagcttttattacccactgaattttcagactatctt
aggcttcagagagaggctcttttctatgaacttcgttctctagttgatctcttaaaccca
tacctgctacagccaagacctgctcttgtggaggtacatttcctaagccggaacactcaa
gcttttttcagggtgtttggctcttgcagcaaaacaattgagatgctaacagggaggatt
acagtgtttacagaacaaccttcagcgccgacctggaatggtaactttttccctcctcag
atgaccttacttccactgcctccacaaagaccttcttaccatgacctggttttccagtgt
ggttctgacagcactactgataaccaaactggagtcaggtatgtttctataaaacctgat
aaccgaaaattggccaacggaacaaatgtcctcggcttactgattgacactttattaaag
gaaggctttcatttggtcagcactagaacagtatcttctgaagacaaaactgaatgctat
agctttgaaaggataaaaagccctgaagtgctcatcacgaatgaaacaccaaaaccagag
actatcatcataccagagcaatctcagataaagaaatga

DBGET integrated database retrieval system