KEGG   Homo sapiens (human): 283537
Entry
283537            CDS       T01001                                 
Symbol
SLC46A3, FKSG16
Name
(RefSeq) solute carrier family 46 member 3
  KO
K20840  MFS transporter, PCFT/HCP family, solute carrier family 46, member 3
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    283537 (SLC46A3)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC46: Folate transporter
   283537 (SLC46A3)
SSDB
Motif
Pfam: MFS_1
Other DBs
NCBI-GeneID: 283537
NCBI-ProteinID: NP_001334889
OMIM: 616764
HGNC: 27501
Ensembl: ENSG00000139508
Pharos: Q7Z3Q1(Tdark)
UniProt: Q7Z3Q1 A0A024RDN9
Position
13:complement(28700080..28718970)
AA seq 461 aa
MKILFVEPAIFLSAFAMTLTGPLTTQYVYRRIWEETGNYTFSSDSNISECEKNKSSPIFA
FQEEVQKKVSRFNLQMDISGLIPGLVSTFILLSISDHYGRKFPMILSSVGALATSVWLCL
LCYFAFPFQLLIASTFIGAFCGNYTTFWGACFAYIVDQCKEHKQKTIRIAIIDFLLGLVT
GLTGLSSGYFIRELGFEWSFLIIAVSLAVNLIYILFFLGDPVKECSSQNVTMSCSEGFKN
LFYRTYMLFKNASGKRRFLLCLLLFTVITYFFVVIGIAPIFILYELDSPLCWNEVFIGYG
SALGSASFLTSFLGIWLFSYCMEDIHMAFIGIFTTMTGMAMTAFASTTLMMFLARVPFLF
TIVPFSVLRSMLSKVVRSTEQGTLFACIAFLETLGGVTAVSTFNGIYSATVAWYPGFTFL
LSAGLLLLPAISLCVVKCTSWNEGSYELLIQEESSEDASDR
NT seq 1386 nt   +upstreamnt  +downstreamnt
atgaagattttatttgtagaacctgccattttccttagtgcatttgctatgactttgacc
ggtccactgacaacgcaatatgtttatcggagaatatgggaagaaactggcaactacact
ttttcatctgatagcaatatttctgagtgtgaaaaaaacaaaagcagcccaatttttgca
ttccaggaggaagttcagaaaaaagtgtcacgttttaatctgcagatggacataagtgga
ttaattcctggtctagtgtctacattcatacttttgtctattagtgatcactacggacga
aaattccctatgattttgtcttccgttggtgctcttgcaaccagcgtttggctctgtttg
ctttgctattttgcctttccattccagcttttgattgcatctaccttcattggtgcattt
tgtggcaattataccacattttggggagcttgctttgcctatatagttgatcagtgtaaa
gaacacaaacaaaaaacaattcgaatagctatcattgactttctacttggacttgttact
ggactaacaggactgtcatctggctattttattagagagctaggttttgagtggtcgttt
ctaattattgctgtgtctcttgctgttaatttgatctatattttattttttctcggagat
ccagtgaaagagtgttcatctcagaatgttactatgtcatgtagtgaaggcttcaaaaac
ctattttaccgaacttacatgctttttaagaatgcttctggtaagagacgatttttgctc
tgtttgttactttttacagtaatcacttatttttttgtggtaattggcattgccccaatt
tttatcctttatgaattggattcaccactctgctggaatgaagtttttataggttatgga
tcagctttgggtagtgcctcttttttgactagtttcctaggaatatggcttttttcttat
tgtatggaagatattcatatggccttcattgggatttttaccacgatgacaggaatggct
atgaccgcgtttgccagtacaacactgatgatgtttttagccagggtgccgttccttttc
actattgtgccattctctgttctacggtccatgttgtcaaaagtggttcgttcgactgaa
caaggtaccctgtttgcttgtattgctttcttagaaacacttggaggagtcactgcagtt
tctacttttaatggaatttactcagccactgttgcttggtaccctggcttcactttcctg
ctgtctgctggtctgttactacttccagccatcagtctatgtgttgtcaagtgtaccagc
tggaatgagggaagctatgaacttcttatacaagaagaatccagtgaagatgcttcagac
aggtga

DBGET integrated database retrieval system