KEGG   Homo sapiens (human): 283554Help
Entry
283554            CDS       T01001                                 

Gene name
GPR137C, TM7SF1L2
Definition
(RefSeq) G protein-coupled receptor 137C
  KO
K22989  integral membrane protein GPR137
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    283554 (GPR137C)
G protein-coupled receptors [BR:hsa04030]
 Others
  Others
   Orphan GPCRs
    283554 (GPR137C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF4420
Motif
Other DBs
NCBI-GeneID: 283554
NCBI-ProteinID: NP_001093122
HGNC: 25445
Ensembl: ENSG00000180998
Vega: OTTHUMG00000171104
Pharos: Q8N3F9(Tdark)
UniProt: Q8N3F9 B3KW22 Q6AWC7
Position
14q22.1
AA seq 429 aa AA seqDB search
MRVSVPGPAAAAAPAAGREPSTPGGGSGGGGAVAAASGAAVPGSVQLALSVLHALLYAAL
FAFAYLQLWRLLLYRERRLSYQSLCLFLCLLWAALRTTLFSAAFSLSGSLPLLRPPAHLH
FFPHWLLYCFPSCLQFSTLCLLNLYLAEVICKVRCATELDRHKILLHLGFIMASLLFLVV
NLTCAMLVHGDVPENQLKWTVFVRALINDSLFILCAISLVCYICKITKMSSANVYLESKG
MSLCQTVVVGSVVILLYSSRACYNLVVVTISQDTLESPFNYGWDNLSDKAHVEDISGEEY
IVFGMVLFLWEHVPAWSVVLFFRAQRLNQNLAPAGMINSHSYSSRAYFFDNPRRYDSDDD
LPRLGSSREGSLPNSQSLGWYGTMTGCGSSSYTVTPHLNGPMTDTAPLLFTCSNLDLNNH
HSLYVTPQN
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgagggtgtccgtgccgggtccggcggccgctgccgcccccgcagccggccgcgagccc
tccacgcccggcgggggcagcggaggcggaggcgccgtcgctgcagcctcaggcgccgcg
gtgccgggctccgtgcagttggcgctgagcgtcctgcacgccctgctctacgccgcgctg
ttcgcctttgcctacctgcagctgtggcggctgctcctgtaccgcgagcggcggctgagt
taccagagcctctgcctcttcctctgtctcctgtgggcagcgctcaggaccaccctcttc
tccgccgccttctcgctcagcggctccctgcccttgctccggccgcccgctcacctgcac
ttcttcccccactggctgctctactgcttcccctcctgtctccagttctccacgctctgt
ctcctcaacctctacctggcggaggttatatgtaaagtcagatgtgccactgaacttgac
agacacaaaattctactgcatttgggctttataatggcaagcctgctctttttagtggtg
aacttgacttgcgcaatgctagttcatggagatgtcccagaaaatcagttgaagtggact
gtgtttgttcgagcattaattaatgatagcctgtttattctttgtgccatctctttagtg
tgttacatatgcaaaattacaaaaatgtcatcagctaatgtctacctcgaatcaaagggt
atgtctctgtgccagactgtcgtcgtgggctctgtagtcattcttctgtactcttccaga
gcttgttataatttggtggtggtcaccatatctcaggatacattagaaagtccatttaat
tatggctgggataatctttcagataaggctcatgtagaagacataagtggagaagagtat
atagtatttggaatggtcctctttctgtgggaacatgtgccagcatggtcggtggtactg
tttttccgggcacagagattaaaccagaatttggcacctgctggcatgataaatagtcac
agttatagttccagagcttactttttcgacaatccaagacgatatgatagtgatgatgac
ctgccaagactgggaagttcaagagaaggaagtttaccaaattcgcaaagtttgggctgg
tatggcaccatgactgggtgtggcagcagcagttacacagtcactccccacctgaatgga
cctatgacagatactgctcctttgctctttacttgtagtaatttagatttgaacaatcat
catagcttatatgtgacaccacaaaactga

DBGET integrated database retrieval system