KEGG   Homo sapiens (human): 283600
Entry
283600            CDS       T01001                                 
Symbol
SLC25A47, C14orf68, HDCMP, HDMCP, HMFN1655
Name
(RefSeq) solute carrier family 25 member 47
  KO
K15123  solute carrier family 25, member 45/47
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    283600 (SLC25A47)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC25: Mitochondrial carrier
   283600 (SLC25A47)
SSDB
Motif
Pfam: Mito_carr Asp_DH_C
Other DBs
NCBI-GeneID: 283600
NCBI-ProteinID: NP_997000
OMIM: 609911
HGNC: 20115
Ensembl: ENSG00000140107
Pharos: Q6Q0C1(Tbio)
UniProt: Q6Q0C1 A0A024R6H7
Position
14:100323339..100330421
AA seq 308 aa
MDFVAGAIGGVCGVAVGYPLDTVKVRIQTEPKYTGIWHCVRDTYHRERVWGFYRGLSLPV
CTVSLVSSVSFGTYRHCLAHICRLRYGNPDAKPTKADITLSGCASGLVRVFLTSPTEVAK
VRLQTQTQAQKQQRRLSASGPLAVPPMCPVPPACPEPKYRGPLHCLATVAREEGLCGLYK
GSSALVLRDGHSFATYFLSYAVLCEWLSPAGHSRPDVPGVLVAGGCAGVLAWAVATPMDV
IKSRLQADGQGQRRYRGLLHCMVTSVREEGPRVLFKGLVLNCCRAFPVNMVVFVAYEAVL
RLARGLLT
NT seq 927 nt   +upstreamnt  +downstreamnt
atggattttgtcgctggagccatcggaggcgtctgcggtgttgctgtgggctaccccctg
gacacggtgaaggtcaggatccagacggagccaaagtacacaggcatctggcactgcgtc
cgggatacgtatcaccgagagcgcgtgtggggcttctaccggggcctctcgctgcccgtg
tgcacggtgtccctggtatcttccgtgtcttttggcacctaccgccactgcctggcgcac
atctgccggctccggtacggcaaccctgacgccaagcccaccaaggccgacatcacgctc
tcgggatgcgcctccggcctcgtccgcgtgttcctgacgtcgcccactgaggtggccaaa
gtccgcttgcagacgcagacacaggcgcagaagcagcagcggcggctttcggcctcgggg
ccgttggctgtgccccccatgtgtcctgtgcccccagcctgcccagagcccaagtaccgc
gggccactgcactgcctggccacggtagcccgtgaggaggggctgtgcggcctctacaag
ggcagctcggccctggtcttacgggacggccactcctttgccacctacttcctttcctac
gcggtcctctgcgagtggctcagccccgctggccacagccggccagatgtcccgggcgtg
ctggtggccgggggctgtgcaggagtcctggcctgggctgtggccacccccatggacgtg
atcaagtcgagactgcaggcagacgggcagggccagaggcgctaccggggtctcctgcac
tgtatggtgaccagcgttcgagaggagggaccccgggtccttttcaaggggctggtactc
aattgctgccgcgccttccctgtcaacatggtggtcttcgtcgcctatgaggcagtgctg
aggctcgcccggggtctgctcacatag

DBGET integrated database retrieval system