KEGG   Homo sapiens (human): 283638
Entry
283638            CDS       T01001                                 
Symbol
CEP170B, CEP170R, FAM68C, KIAA0284
Name
(RefSeq) centrosomal protein 170B
  KO
K16463  centrosomal protein CEP170
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    283638 (CEP170B)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation proteins
   Centriole proteins
    283638 (CEP170B)
SSDB
Motif
Pfam: CEP170_C FHA Yop-YscD_cpl PLU-1
Other DBs
NCBI-GeneID: 283638
NCBI-ProteinID: NP_001106197
HGNC: 20362
Ensembl: ENSG00000099814
Pharos: Q9Y4F5(Tdark)
UniProt: Q9Y4F5
Position
14:104864513..104896747
AA seq 1554 aa
MSATSWFLVSSSGARHRLPRELIFVGREECELMLQSRSVDKQHAVINYDQDRDEHWVKDL
GSLNGTFVNDMRIPDQKYVTLKLNDVIRFGYDSNMYVLERVQHRVPEEALKHEKYTSQLQ
VSVKGLAPKRSEALPEHTPYCEASNPRPEKGDRRPGTEAASYRTPLYGQPSWWGEDDGST
LPDAQRQGEPYPERPKGPVQQDGELHGFRAPAEPQGCSFRREPSYFEIPTKETPQPSQPP
EVPAHEMPTKDAEAGGGGAAPVVQSHASFTIEFDDCSPGKMKIKDHITKFSLRQRRPPGK
EATPGEMVSAETKVADWLVQNDPSLLHRVGPGDDRHSTKSDLPVHTRTLKGHKHEDGTQS
DSEDPLAKAASAAGVPLEASGEQVRLQRQIKRDPQELLHNQQAFVIEFFDEDTPRKKRSQ
SFTHSPSGDPKADKRRGPTPADRDRPSVPAPVQAGGRSSGPQRAGSLKREKTEERLGSPS
PASRTPARPFGSVGRRSRLAQDFMAQCLRESSPAARPSPEKVPPVLPAPLTPHGTSPVGP
PTPPPAPTDPQLTKARKQEEDDSLSDAGTYTIETEAQDTEVEEARKMIDQVFGVLESPEL
SRASSATFRPVIRGDRDESDDGGVAQRMALLQEFASRPLGAAPQAEHQGLPVPGSPGGQK
WVSRWASLADSYSDPGLTEDGLGRRGGEPEGSLPVRMRRRLPQLPSERADSPAGPESSRR
SGPGPPELDSEQPSRLFGQEELDPDSLSDASGSDGGRGPEPGVEPQDSRRRSPQEGPTWS
RGRRSPRAPGEPTPASFFIGDQNGDAVLSRKPLAAPGDGEGLGQTAQPSPPARDGVYVSA
NGRMVIQLRPGRSPEPDGPAPAFLRQESFTKEPASGPPAPGKPPHISSHPLLQDLAATRA
ARMDFHSQDTHLILKETETALAALEARLLSNSVDAECEGGSTPRPPEDALSGDSDVDTAS
TVSLRSGKSGPSPTTPQPLRAQKEMSPSPPAAQDPGGTALVSAREQSSERQHHPLGPTDM
GRGEPVRRSAIRRGHRPRGSLDWPSEERGPVLAHLPSSDVMASNHETPEATGAGRLGSRR
KPAAPPPSPAAREEQSRSSASSQKGPQALTRSNSLSTPRPTRASRLRRARLGDASDTEAA
DGERGSLGNPEPVGRPAAEQAKKLSRLDILAMPRKRAGSFTGTSDPEAAPARTSFSGRSV
ELCCASRKPTMAEARAVSRKAANTATTTGPRQPFSRARSGSARYTSTTQTPRAGSSSRAR
SRAPGPRDTDDDEEEPDPYGFIVQTAEIAEIARLSQTLVKDVAILAQEIHDVAGDGDTLG
SSEPAHSASLSNMPSTPASTISAREELVQRIPEASLNFQKVPPGSLNSRDFDQNMNDSCE
DALANKTRPRNREEVIFDNLMLNPVSQLSQAIRENTEHLAEKMKILFQNTGRAWEDLEAR
INAENEVPILKTSNKEISSILKELRRVQKQLEVINAIVDPSGSLDLLTGNRSLASSAQPG
LGKGRVAAQSPPSPASAEALLPALPLRNFPQRASCGPPSLPDPTFLPDAERFLI
NT seq 4665 nt   +upstreamnt  +downstreamnt
atgagtgccacgtcctggttcctggtgagcagcagcggcgcccgccaccggctccctcgg
gagctcatcttcgtggggcgtgaggagtgtgagctcatgctacagtcccgcagcgtggac
aagcagcatgccgtcatcaactacgaccaggacagggacgagcactgggtgaaggacctg
ggcagcctcaatgggacgtttgtgaatgacatgcgcatcccggaccagaagtacgtcacg
ctgaagctcaacgatgtcatccgcttcggctacgattccaacatgtatgtgctggagcgt
gtgcagcaccgagtcccggaggaggcactcaagcatgaaaagtacaccagccagctgcag
gtgagcgtgaagggtttggcgcccaagaggagcgaggcactgccggaacacacaccatac
tgcgaggcctcgaaccccaggccggagaagggggaccggagaccaggaacagaggcagcc
tcttaccgcacacccctgtatgggcagccctcctggtggggtgaggacgatggtagcacg
ctgcctgacgcccagcgccagggagagccctacccagagcgccccaagggaccagtgcag
caggacggggagctccacggcttccgcgcccctgctgagcctcagggctgctcgttccgg
cgggagcccagctacttcgagatccccacgaaggagaccccgcagccgtcgcagcccccc
gaggtgccggcacacgagatgcccacgaaggatgcagaggcaggtgggggcggagcggcc
cctgtggtgcagagccacgcctccttcaccatcgagtttgatgactgcagccctggcaag
atgaagatcaaggaccatatcaccaagttttccctgcgccagcggcggcccccgggcaag
gaggccacacctggcgagatggtgtcggctgagaccaaggtggccgactggctggtgcag
aatgacccgagcctgctgcaccgggttggccctggggatgaccgccacagcaccaagagc
gacctgcctgtccacacccgcaccctgaagggccacaagcacgaggacggcacgcagagt
gactcagaggaccccctggccaaggcggcctcggccgctggggtgcccttggaggccagc
ggggagcaggtgcggctgcagaggcagatcaagcgggacccccaggagctactacataac
cagcaggcctttgtcatcgagttcttcgacgaggacacaccccgaaagaagcgctcccag
tccttcacgcacagcccgtccggggaccccaaggccgacaagcgccgtggcccaacgccg
gccgatagggaccgccccagtgtcccagccccagtccaggcagggggccgcagctcgggg
ccacagagggccggctcgctcaagcgggagaagacagaggaacggctgggcagcccctcg
cccgcctcccgaacccctgcccgccccttcggaagcgtggggcgccgctcccgcctggcc
caggacttcatggcccagtgtctgcgggagagctccccggccgcccggcccagccccgag
aaggttcctccggtgctgcccgctcccctgacaccccatgggaccagccccgtgggcccc
ccgaccccaccgcccgcccccacggacccccagctgaccaaggcacggaaacaggaggag
gacgacagcctcagtgacgcagggacatacaccatcgagaccgaggcgcaggacacggag
gtggaggaggcccggaagatgatcgaccaggtctttggggtgttggagtcccctgaactc
tccagggcatcttcggccacctttcgcccagtcatcagaggggacagagatgagtctgat
gacgggggcgtggcccagcggatggcgctactgcaggagtttgcctcccggccactgggt
gcggccccccaggcggagcaccagggcctcccggtgccgggctcccctgggggtcagaag
tgggtgtcccgctgggccagcctggctgacagctactcagacccgggcctcacagaggat
ggcctgggacgtagaggcggggagccggaggggtccctgcctgtgcgcatgcggcgacgg
ctccctcagctgcccagtgagagggctgacagccctgcgggcccagagagcagcaggagg
agtgggcctgggccaccggagctggacagtgagcagcccagccgcctcttcggccaggag
gagttggatcctgacagcctcagcgatgccagtgggtcggacgggggccgaggccccgag
ccaggggtggagccacaggacagcagacgcaggagcccccaggaggggcccacgtggagc
aggggtcggcgctcaccaagggcccccggggagccaactcccgcctctttcttcattggg
gaccagaatggggacgctgtgttatctaggaaaccgcttgcggctccaggggatggggag
ggcctagggcagacagcccagcccagccccccagcacgggatggcgtctatgtcagtgcc
aatgggagaatggtcatccagctacggcctggacggtccccagaacccgacggccctgcc
ccagcctttctccggcaagagagcttcactaaggagccagccagtggtcccccagcgccc
ggcaagcccccccacatctccagccacccgcttctacaggacctggccgctacccgggcc
gcacgcatggacttccactcccaggacacccacctgatcttgaaggagacggagacggcc
ctggcggccctggaggcccgactcctctctaattctgtggatgccgagtgtgaggggggc
agcaccccgaggccgccggaggacgccctgtctggggactcggacgtggacacagccagc
accgtcagcctgcgtagtggcaagagcgggcccagccccacaaccccccagcctctgcgg
gcacagaaggagatgtcgccatccccgccagctgcacaggacccgggaggcaccgccctg
gtcagtgcccgtgagcagtcctcagagaggcagcatcacccacttggcccgacggacatg
ggccgtggagagccggtacggcgctcagccataaggcgtggccacaggccccgagggtcc
ctggattggcccagtgaggagcgtggccctgtcctcgcccacctacccagctcagatgtg
atggcctccaaccacgaaacccctgaggccaccggggcaggacggctaggttctcgccgg
aaaccagcggccccaccgccatccccagctgcccgggaggagcagagccgtagctcagcc
agctcccagaaggggccgcaggccttgacccgctccaacagcctgtccacccctcgcccc
acacgggcctcccggctgaggcgggcccggctgggggacgcttcagacactgaggctgcg
gatggtgagcgggggtccctgggcaaccctgagcccgtgggccggccagctgctgagcag
gccaagaagctgtcacgcctggacatcctggccatgccccggaagcgggccggctccttc
acagggactagtgaccccgaggcagcccctgcccgcaccagcttctctggccgcagtgtg
gagttgtgctgtgccagccgcaagcccaccatggccgaagcacgggctgtctccaggaag
gctgccaacacagccaccaccacgggtccccgccagcccttcagcagggcccgctcaggc
agtgcccgatacacctccaccactcagaccccgagggctggcagctccagccgggctcgt
tcccgggcccccggcccccgggacacggacgacgatgaggaggagcctgacccttatggt
ttcatcgtgcagacggcagagattgcggagattgccaggctgagccagacgctggtgaag
gacgtggccatcctagcccaggagatccacgatgtggctggggacggtgacacactgggc
tcctcggagcctgcccacagcgcctccctcagcaacatgcccagcacccccgcctcgacc
atctctgcccgggaggagctggtgcagcgcatccccgaggccagcctcaacttccagaag
gtgccgcccggctcgctgaactctcgggactttgaccagaacatgaacgacagctgtgag
gacgccctggccaacaagacgcggcctcggaaccgagaggaggtgatcttcgataacctg
atgctgaacccggtgtcccagctgtcgcaggccatccgtgagaacacagagcaccttgcc
gagaagatgaagatcctctttcagaacacagggagagcttgggaggacctggaagccagg
atcaacgccgagaacgaggtgcccatcctgaagacatctaacaaggaaatcagctccatc
ctgaaggaactgaggcgggtgcagaaacagctggaagttatcaatgccatcgtggacccc
agtgggagcctggacctgctcacaggaaacaggagcttggccagctctgcacagccgggg
ctggggaagggccgcgtggctgcccagagcccaccctcacccgcctcagccgaggccctg
ctgccagccctgcccctgaggaatttcccacagcgggccagctgtgggcctcccagcctc
ccggaccccaccttcctccctgatgccgagaggttcctgatctag

DBGET integrated database retrieval system