KEGG   Homo sapiens (human): 283643Help
Entry
283643            CDS       T01001                                 

Gene name
TEDC1, C14orf80
Definition
(RefSeq) tubulin epsilon and delta complex 1
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: DUF4510 DUF4509
Motif
Other DBs
NCBI-GeneID: 283643
NCBI-ProteinID: NP_001128347
HGNC: 20127
Ensembl: ENSG00000185347
Vega: OTTHUMG00000170426
Pharos: Q86SX3(Tdark)
UniProt: Q86SX3
Position
14q32.33
AA seq 426 aa AA seqDB search
MGRRRQRVDPAAGARAGALPEAIAALSRSLPSGPSPEIFRRAKFDRPEATSALWQLLFRV
LSPLPAGNALASLALEVQARLVKSALCSQGYPRLALAQLPEDGSQGSRELLLALSWLLAR
GPVPEQMLAQARVPLGDEMTVCQCEALASPGPPAPHMEAEGPVDVRHVQWLMGKLRFRWR
QLVSSQQEQCALLSKIHLYTRGCHSDQSLSHLSVTEAEMLRDPEGGQQLLRTLERENQRL
EAVLAWRRSELVFWRWMDTVLGTCAPEVPAAASQPTFLPWVPERGGGELDLVVRELQALE
EELREAAERRRAAWEAKAGGCGRGPEWSAARRASREAVEKELGALQQCWERDGGPAQPHG
PHRLVRREDGAAGDRDLRAAVVIRTLRSQEACLEAVLRRLQGQCRQELARLVGARPGLIW
IPPPGR
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atggggaggcggcggcagcgggtggaccccgcggctggggcccgggccggggccctgcct
gaggccatcgccgcgttgagtcggtcgctgccctcgggacccagccccgagatcttccgc
cgcgccaagttcgaccgtccggaggcgacctccgcgctctggcagctcctcttccgtgtg
ctctcgccactccctgcgggcaacgccttggcatcgctcgccctggaggtccaagcccgc
ttggtgaagtcagcactatgctcccagggctacccgaggctggcactggcacaactacct
gaggatggctcgcagggcagtcgggagctgctgctggctctgtcctggctcttggcccga
ggacctgtgcccgagcagatgctggcccaggcccgagtgcctctgggtgacgagatgact
gtgtgccagtgtgaggccctggccagccctggcccacctgcaccccacatggaagcagag
ggtcctgtggatgtccgccatgtgcagtggctgatgggaaagctgcggttccggtggcgc
cagctggtgtccagtcagcaggagcagtgcgccctcctgagcaagatccacctgtacaca
cgcggctgccacagcgaccagagccttagccatctgtctgtcactgaagcagagatgctc
agggacccagagggaggccagcagctgctgcggactctggagcgtgagaaccagcgcctg
gaggctgtcctggcgtggcggcgctctgagctggtcttctggcggtggatggacacggtc
ctgggcacctgtgccccggaggtgcctgctgcagcctcacagcccaccttcctgccctgg
gtccccgagcgcgggggtggcgagttggacctggtagtgcgggagctgcaggcactggag
gaggagctgcgggaggctgcggagcgcaggcgggcggcctgggaggccaaggctggaggc
tgtggacgggggccagagtggagtgccgcgcggcgggcctctcgggaggctgtggaaaag
gagctgggagctctacagcagtgctgggagcgagacggtggcccggcccagccccatggg
ccacaccggctggtgagacgagaggatggggcagcaggggaccgggacctgcgggcagct
gtggtgatcaggacgctgaggagccaggaggcctgcctggaggcggtgctacgtcgacta
cagggacagtgtcggcaggaactggccaggctggtgggagcccgccctggtctcatctgg
atcccgccacctggacgctga

DBGET integrated database retrieval system