KEGG   Homo sapiens (human): 283652
Entry
283652            CDS       T01001                                 

Symbol
SLC24A5, JSX, NCKX5, OCA6, SHEP4
Name
(RefSeq) solute carrier family 24 member 5
  KO
K13753  solute carrier family 24 (sodium/potassium/calcium exchanger), member 5
Organism
hsa  Homo sapiens (human)
Disease
H00168  Oculocutaneous albinism
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    283652 (SLC24A5)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC24: Na+/(Ca2+-K+) exchanger
   283652 (SLC24A5)
SSDB
Motif
Pfam: Na_Ca_ex
Other DBs
NCBI-GeneID: 283652
NCBI-ProteinID: NP_995322
OMIM: 609802
HGNC: 20611
Ensembl: ENSG00000188467
Vega: OTTHUMG00000131494
Pharos: Q71RS6(Tbio)
UniProt: Q71RS6
Position
15q21.1
AA seq 500 aa
MQTKGGQTWARRALLLGILWATAHLPLSGTSLPQRLPRATGNSTQCVISPSSEFPEGFFT
RQERRDGGIIIYFLIIVYMFMAISIVCDEYFLPSLEIISESLGLSQDVAGTTFMAAGSSA
PELVTAFLGVFITKGDIGISTILGSAIYNLLGICAACGLLSNTVSTLSCWPLFRDCAAYT
ISAAAVLGIIYDNQVYWYEGALLLLIYGLYVLVLCFDIKINQYIIKKCSPCCACLAKAME
RSEQQPLMGWEDEGQPFIRRQSRTDSGIFYEDSGYSQLSISLHGLSQVSEDPPSVFNMPE
ADLKRIFWVLSLPIITLLFLTTPDCRKKFWKNYFVITFFMSAIWISAFTYILVWMVTITG
ETLEIPDTVMGLTLLAAGTSIPDTIASVLVARKGKGDMAMSNIVGSNVFDMLCLGIPWFI
KTAFINGSAPAEVNSRGLTYITISLNISIIFLFLAVHFNGWKLDRKLGIVCLLSYLGLAT
LSVLYELGIIGNNKIRGCGG
NT seq 1503 nt   +upstreamnt  +downstreamnt
atgcagacaaaagggggccaaacatgggcgagaagggctctgttgctcggcatcctgtgg
gccactgcacatctgcctctctcagggacctccctgccccaacgtctcccaagggccaca
ggaaatagcacccaatgtgttatttctccatcatcggagtttcccgaagggtttttcacg
agacaggagcgcagagatggaggcatcataatctatttcctaattatcgtttacatgttc
atggccatatctattgtctgtgatgaatacttcctaccctccctggaaatcatcagtgaa
tcccttggattgtctcaggatgttgcaggcacaactttcatggcagcgggcagttcagct
cctgaattagttactgctttcctaggtgtatttatcacaaagggagatattggcattagc
accatccttggatctgcaatttataatctccttggcatctgtgctgcctgtggtttgcta
tctaatacggtctcaacactatcatgttggcccctattcagagactgtgcagcgtacaca
attagtgcagcagcagttcttggtataatatatgacaaccaagtttactggtatgaaggg
gctttactgcttttgatatatggattgtatgttttggtgctgtgttttgacattaaaatt
aaccaatatattataaagaaatgcagtccttgctgcgcctgtcttgccaaagctatggag
agaagtgaacaacagccactgatgggctgggaagatgaaggtcaaccattcattcgtcgg
caatcaagaactgatagtggaatattttatgaagattctggctactctcagctctctata
agtttacatggccttagtcaggtttctgaagatccaccaagtgttttcaacatgcctgaa
gcagacttaaaaagaattttttgggtattatcccttcctattattacattactttttcta
accacaccagattgtagaaaaaagttttggaaaaactactttgtgataacctttttcatg
tctgcaatatggatatccgcatttacatatatcctggtttggatggtcacaataactggg
gaaacactagaaattcccgatacagtaatgggccttactttattagcagcaggaacaagc
ataccagacacaattgcaagtgtgttggttgcaagaaaagggaaaggagatatggctatg
tctaacatcgtgggatccaatgtgtttgatatgttgtgccttggtattccatggtttatt
aaaactgcatttataaatggatcagctcctgcagaagtaaacagcagaggactaacttac
ataaccatctctctcaacatttcaattatttttctttttttagcagttcacttcaatggc
tggaaactagacagaaagttgggaatagtctgcctattatcatacttggggcttgctaca
ttatcagttctatatgaacttggaattattggaaataataaaataaggggctgtggaggt
tga

DBGET integrated database retrieval system