KEGG   Homo sapiens (human): 2837Help
Entry
2837              CDS       T01001                                 

Gene name
UTS2R, GPR14, UR-2-R, UTR, UTR2
Definition
(RefSeq) urotensin 2 receptor
  KO
K04241  urotensin 2 receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    2837 (UTS2R)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Cardiovascular peptide
   Urotensin II
    2837 (UTS2R)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srv 7TM_GPCR_Srw 7TM_GPCR_Srsx 7tm_4
Motif
Other DBs
NCBI-GeneID: 2837
NCBI-ProteinID: NP_061822
OMIM: 600896
HGNC: 4468
Ensembl: ENSG00000181408
Vega: OTTHUMG00000178835
Pharos: Q9UKP6(Tchem)
UniProt: Q9UKP6
Position
17q25.3
AA seq 389 aa AA seqDB search
MALTPESPSSFPGLAATGSSVPEPPGGPNATLNSSWASPTEPSSLEDLVATGTIGTLLSA
MGVVGVVGNAYTLVVTCRSLRAVASMYVYVVNLALADLLYLLSIPFIVATYVTKEWHFGD
VGCRVLFGLDFLTMHASIFTLTVMSSERYAAVLRPLDTVQRPKGYRKLLALGTWLLALLL
TLPVMLAMRLVRRGPKSLCLPAWGPRAHRAYLTLLFATSIAGPGLLIGLLYARLARAYRR
SQRASFKRARRPGARALRLVLGIVLLFWACFLPFWLWQLLAQYHQAPLAPRTARIVNYLT
TCLTYGNSCANPFLYTLLTRNYRDHLRGRVRGPGSGGGRGPVPSLQPRARFQRCSGRSLS
SCSPQPTDSLVLAPAAPARPAPEGPRAPA
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atggcgctgacccccgagtccccgagcagcttccctgggctggccgccactggcagctct
gtgccggagccgcctggcggccccaacgcaaccctcaacagctcctgggccagcccgacc
gagcccagctccctggaggacctggtggccacgggcaccattgggactctgctgtcggcc
atgggcgtggtgggcgtggtgggcaacgcctacacgctggtggtcacctgccgctccctg
cgtgcggtggcctccatgtacgtctacgtggtcaacctggcgctggccgacctgctgtac
ctgctcagcatccccttcatcgtggccacctacgtcaccaaggagtggcacttcggggac
gtgggctgccgcgtgctcttcggcctggacttcctgaccatgcacgccagcatcttcacg
ctgaccgtcatgagcagcgagcgctacgctgcggtgctgcggccgctggacaccgtgcag
cgccccaagggctaccgcaagctgctggcgctgggcacctggctgctggcgctgctgctg
acgctgcccgtgatgctggccatgcggctggtgcgccggggtcccaagagcctgtgcctg
cccgcctggggcccgcgcgcccaccgcgcctacctgacgctgctcttcgccaccagcatc
gcggggcccgggctgctcatcgggctgctctacgcgcgcctggcccgcgcctaccgccgc
tcgcagcgcgcctccttcaagcgggcccggcggccgggggcgcgcgcgctgcgcctggtg
ctgggcatcgtgctgctcttctgggcctgcttcctgcccttctggctgtggcagctgctc
gcccagtaccaccaggccccgctggcgccgcggacggcgcgcatcgtcaactacctgacc
acctgcctcacctacggcaacagctgcgccaaccccttcctctacacgctgctcaccagg
aactaccgcgaccacctgcgcggccgcgtgcggggcccgggcagcgggggaggccggggg
cccgttccctccctgcagccccgcgcccgcttccagcgctgttcgggccgctccctgtct
tcctgcagcccacagcccactgacagcctcgtgctggccccagcggccccggcccgacct
gcgcccgagggtcccagggccccggcgtga

DBGET integrated database retrieval system