KEGG   Homo sapiens (human): 283742
Entry
283742            CDS       T01001                                 
Symbol
FAM98B
Name
(RefSeq) family with sequence similarity 98 member B
  KO
K15434  protein FAM98B
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:hsa03016]
    283742 (FAM98B)
Transfer RNA biogenesis [BR:hsa03016]
 Eukaryotic type
  tRNA spricing factors
   tRNA splicing ligase complex
    283742 (FAM98B)
SSDB
Motif
Pfam: DUF2465 DotA VIT1
Other DBs
NCBI-GeneID: 283742
NCBI-ProteinID: NP_775882
OMIM: 616142
HGNC: 26773
Ensembl: ENSG00000171262
Pharos: Q52LJ0(Tdark)
UniProt: Q52LJ0
Position
15:38454127..38487710
AA seq 433 aa
MRGPEPGPQPTMEGDVLDTLEALGYKGPLLEEQALTKAAEGGLSSPEFSELCIWLGSQIK
SLCNLEESITSAGRDDLESFQLEISGFLKEMACPYSVLISGDIKDRLKKKEDCLKLLLFL
STELQASQILQNKKHKNSQLDKNSEVYQEVQAMFDTLGIPKSTTSDIPHMLNQVESKVKD
ILSKVQKNHVGKPLLKMDLNSEQAEQLERINDALSCEYECRRRMLMKRLDVTVQSFGWSD
RAKVKTDDIARIYQPKRYALSPKTTITMAHLLAAREDLSKIIRTSSGTSREKTACAINKV
LMGRVPDRGGRPNEIEPPPPEMPPWQKRQEGGGGRGGWGGGGGGGGRGGGGGGGGRGGWG
GGGGGWGGGGGGGGGWGGGGGGGRGGFQGRGDYGGRGGYGGRGGYGGRGYGDPYGGGGGG
GGGGGGGGGYRRY
NT seq 1302 nt   +upstreamnt  +downstreamnt
atgagagggccggagccgggtccccaaccgacgatggagggagacgtgctggacacactg
gaggcgctggggtataaaggaccattgttagaagagcaagcccttacaaaggcggcagag
ggtggattatcttcacctgaattttcagagctctgtatttggttaggctctcaaataaaa
tcattatgcaacttggaagaaagtatcacgtctgctggaagagatgatctagagagcttc
cagcttgagataagtggctttttaaaagaaatggcatgtccatattctgtactcatatca
ggagatattaaagatcgtttaaaaaagaaggaggactgtttgaaacttctattattttta
agtacagaacttcaagcttcacagatattacagaacaagaaacataaaaattctcaatta
gataaaaatagtgaagtttatcaggaagttcaagctatgtttgatacacttggtataccc
aagtcaacaacttctgacattccgcatatgctaaaccaagtggaatcaaaggtgaaagat
attctctcaaaggtccagaaaaatcatgtgggaaaaccactgctgaaaatggatttaaat
tcagaacaggcggaacaactggaaagaatcaatgatgctctttcctgtgaatatgagtgc
cgccgacgaatgttaatgaaacgattagatgtgactgtacagtcctttggatggtctgat
agagcaaaggtaaaaacagatgatatagcaagaatttatcagcctaagcgttatgctttg
tcacccaagacaacgattacaatggcacatctacttgctgctcgtgaagatctatccaag
atcattaggacaagtagtggcaccagccgggagaagaccgcatgtgccattaataaggtg
ctgatgggaagggtgcctgacaggggaggccggccgaatgaaattgaaccaccacctcca
gaaatgcccccttggcaaaagagacaagaaggcggcggtggaaggggtggttggggtggt
ggtggtggaggtggtggtagaggaggtggtgggggtgggggtgggagaggtggctggggg
ggtggaggaggaggttggggaggtggtgggggagggggaggagggtgggggggaggagga
ggaggtggtagaggaggtttccaaggcaggggagattatggtggaagagggggttatggt
ggaagagggggctatggtggaagaggctatggagatccatatggaggaggtggtggtggt
ggtggtggtggtggtggaggaggtggatatagaagatactaa

DBGET integrated database retrieval system