KEGG   Homo sapiens (human): 2838Help
Entry
2838              CDS       T01001                                 

Gene name
GPR15, BOB
Definition
(RefSeq) G protein-coupled receptor 15
  KO
K08403  G protein-coupled receptor 15
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    2838 (GPR15)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Chemokine
   Chemokine like
    2838 (GPR15)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 Srg 7TM_GPCR_Srv Shisa ESF1
Motif
Other DBs
NCBI-GeneID: 2838
NCBI-ProteinID: NP_005281
OMIM: 601166
HGNC: 4469
Ensembl: ENSG00000154165
Vega: OTTHUMG00000160017
Pharos: P49685(Tbio)
UniProt: P49685 B6V9G9 B2R8H6
Position
3q11.2
AA seq 360 aa AA seqDB search
MDPEETSVYLDYYYATSPNSDIRETHSHVPYTSVFLPVFYTAVFLTGVLGNLVLMGALHF
KPGSRRLIDIFIINLAASDFIFLVTLPLWVDKEASLGLWRTGSFLCKGSSYMISVNMHCS
VLLLTCMSVDRYLAIVWPVVSRKFRRTDCAYVVCASIWFISCLLGLPTLLSRELTLIDDK
PYCAEKKATPIKLIWSLVALIFTFFVPLLSIVTCYCCIARKLCAHYQQSGKHNKKLKKSI
KIIFIVVAAFLVSWLPFNTFKFLAIVSGLRQEHYLPSAILQLGMEVSGPLAFANSCVNPF
IYYIFDSYIRRAIVHCLCPCLKNYDFGSSTETSDSHLTKALSTFIHAEDFARRRKRSVSL
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atggacccagaagaaacttcagtttatttggattattactatgctacgagcccaaactct
gacatcagggagacccactcccatgttccttacacctctgtcttccttccagtcttttac
acagctgtgttcctgactggagtgctggggaaccttgttctcatgggagcgttgcatttc
aaacccggcagccgaagactgatcgacatctttatcatcaatctggctgcctctgacttc
atttttcttgtcacattgcctctctgggtggataaagaagcatctctaggactgtggagg
acgggctccttcctgtgcaaagggagctcctacatgatctccgtcaatatgcactgcagt
gtcctcctgctcacttgcatgagtgttgaccgctacctggccattgtgtggccagtcgta
tccaggaaattcagaaggacagactgtgcatatgtagtctgtgccagcatctggtttatc
tcctgcctgctggggttgcctactcttctgtccagggagctcacgctgattgatgataag
ccatactgtgcagagaaaaaggcaactccaattaaactcatatggtccctggtggcctta
attttcaccttttttgtccctttgttgagcattgtgacctgctactgttgcattgcaagg
aagctgtgtgcccattaccagcaatcaggaaagcacaacaaaaagctgaagaaatctata
aagatcatctttattgtcgtggcagcctttcttgtctcctggctgcccttcaatactttc
aagttcctggccattgtctctgggttgcggcaagaacactatttaccctcagctattctt
cagcttggtatggaggtgagtggacccttggcatttgccaacagctgtgtcaaccctttc
atttactatatcttcgacagctacatccgccgggccattgtccactgcttgtgcccttgc
ctgaaaaactatgactttgggagtagcactgagacatcagatagtcacctcactaaggct
ctctccaccttcattcatgcagaagattttgccaggaggaggaagaggtctgtgtcactc
taa

DBGET integrated database retrieval system